KEGG   Castor canadensis (American beaver): 109699345Help
Entry
109699345         CDS       T04791                                 

Gene name
Lig4
Definition
(RefSeq) DNA ligase 4 isoform X1
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    109699345 (Lig4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccan03400]
    109699345 (Lig4)
Enzymes [BR:ccan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109699345 (Lig4)
DNA repair and recombination proteins [BR:ccan03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     109699345 (Lig4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_IV DNA_ligase_A_C BRCT BRCT_2 RNA_ligase mRNA_cap_enzyme LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 109699345
NCBI-ProteinID: XP_020039591
LinkDB All DBs
Position
Unknown
AA seq 911 aa AA seqDB search
MAASQTSQTVASHVPFADLCSTLERIQKSKGHVEKIRHFTEFLDSWRKFHDALHKNQKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPRQGKDALKLLNYRTPSAVHS
DAGDFALTAYFVLKPRCLQKGSLSIQQVNELLDSVASNNSSKRKDLVKKSLLQLITQSSA
LEQKWLIRMILKDLKLGVGQQTVFPVFHSDATELYSVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFRPMLAAIADVERIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYTD
QFGASPQEGSLTPFIHNAFRTDVQVCILDGEMMAYNPNTQTFMQKGDKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGRETLRKRYEILSGTFIPIQGRMEIVQKTQAHTKNEVVDALNE
AIDKREEGIMVKHPLSIYKPDKRGEGWLKIKPEYVSGLMDELDILIVGGYWGKGSRGGMM
SHFLCAVAEKPPPGKRPSVFHTLSRVGSGYTMKELYDLGLKLAKHWKPFHKKTPPSSIIC
GTEKPEVYIEPCNSVIVQVKAAEIVPSEMYKTGCTLRFPRIKKVRDDKEWHECMTLDDLE
QLRGKASGKLVSKHLDVGGDDEPQEKKRKTAPKMKKVIGIIEHLKAPNLSNISKVSNIFE
DVEFCVMSGTGSHTKPELENRIAEFGGYIVQNPGPDTYCVIAGSENIRVKNIISSDKHDV
VKPEWLLECFKTQSCVPWQPRFMIHMCPSTKQHFACEYDCYGDSYFVDTDLSQLKEVFSG
IKNSSAQTPEEMACVIADLECRYSWDHFPLSMFRHHTVYLDLYAVINDPSTKTKGAKLTF
TALELRFHGARVVSCLAEGVSHVVIGEDQSRVADFKAFRRTLKKKFKIVQERWVTESIDR
CELQEENQYLI
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcacaaacttcacaaactgttgcatctcacgttccctttgcagatttatgt
tcaactttagaacgaatacagaaaagtaaaggacatgtagaaaaaattagacactttaca
gaatttttagattcttggagaaaatttcatgatgcccttcataagaaccaaaaagatgtt
acagactctttttacccagcaatgagacttattcttcctcagctggaaagagagagaatg
gcttatggaatcaaagaaactatgcttgctaagctttatattgaattgcttaacttaccg
agacaaggaaaagatgcccttaagctcctgaattacagaaccccttctgcagttcacagt
gatgcgggagacttcgcactgactgcatactttgtgttgaagccaagatgcttacagaaa
ggaagcttaagcatacagcaggtaaatgaacttttagactctgttgccagcaataattct
tccaaaagaaaagacttagtaaagaagagccttctacaacttataactcagagttcagcc
cttgagcaaaagtggctcatacgaatgattttgaaagacttaaagcttggtgttggtcag
caaactgtatttcctgtttttcacagtgatgctactgagctgtatagtgttaccacagat
ctggaaaaggtctgtaggcagctgcatgatccgtctgtaggcctcagtgatatttctatc
acattgttttctgcctttagaccaatgctcgccgccatagcagatgttgagcgcattgaa
aaggacatgaaacaccagagtttctacatcgaaaccaagctcgatggtgagcgtatgcag
atgcacaaagatggggacgtgtaccaatacttctcccgaaatggatataattacactgat
cagtttggtgcttctccgcaggaaggttctctcaccccattcattcataacgcattcaga
acagatgtacaagtctgtatccttgacggtgagatgatggcctacaacccaaatacacaa
acatttatgcagaagggggacaagtttgatattaaaagaatggtagaagattctgatttg
cagacttgttactgtgtttttgatgtattgatggttaataataaaaagctaggacgtgag
accctgagaaagaggtacgagattcttagtggtacttttataccaatacaaggtagaatg
gaaatagtgcagaaaacgcaggctcacactaagaacgaggtggtcgatgcattgaatgag
gcgatagataaaagagaagagggaatcatggtgaagcatcctctgtctatttacaagccg
gacaaaagaggtgaaggatggttaaaaatcaaaccagagtatgtcagcggactgatggat
gaattggacatcttaattgtgggcggctactggggcaaaggttcacggggtggaatgatg
tctcattttttgtgtgcagtggcagagaagcctcctcctgggaagaggccgtctgtattt
cacactctctctcgtgttggctcaggatataccatgaaagagctgtatgatctgggtttg
aaactggccaaacactggaagccttttcataaaaaaactccaccaagtagcattatatgt
ggaacagagaagccagaagtgtacatcgaaccgtgtaattctgtcatcgttcaggttaag
gcagcagagatagtccccagtgaaatgtataaaactggctgtacattgcgttttccacgg
attaagaaggtaagagatgacaaagagtggcatgaatgcatgactctggacgacttagag
caacttaggggaaaggcatctggaaagcttgtgtcaaaacaccttgatgtaggtggtgat
gatgaacctcaagaaaaaaagcggaaaactgccccaaagatgaaaaaagttattggaatt
attgaacacttaaaagcacctaacctttctaacataagcaaagtctctaatatatttgaa
gatgttgagttttgtgtcatgagtggaacaggcagtcatacaaaacctgagctggagaac
agaattgcagaatttggtggctatatagtacaaaatccaggaccagacacatactgtgtt
attgcagggtctgagaacatcagagtgaaaaacataatttcttcagataagcatgatgtt
gtcaagcctgaatggcttttagagtgttttaagacccaaagttgtgtgccatggcaacct
cgctttatgattcatatgtgtccatcaacaaaacagcattttgcctgtgaatatgattgc
tatggtgatagttactttgttgacacggatttgagccaactgaaagaagtattttcggga
attaagaattctagtgcacagactcctgaagaaatggcctgtgtgattgctgatctagag
tgtcggtattcttgggaccactttcctctcagtatgtttcgtcatcacaccgtttatttg
gacttgtatgcggtgattaatgatccaagcaccaaaactaagggagcgaaattaactttt
acagccttggagcttcggtttcatggagcaagagtagtttcttgtttagctgagggggtg
tctcatgtagtcattggagaggatcagagtcgtgttgcagattttaaagcttttagaaga
actcttaagaaaaagtttaaaatcgtacaagaacgttgggtaactgagtcaatagaccgc
tgtgaattgcaagaggaaaatcagtatttgatttaa

DBGET integrated database retrieval system