KEGG   Castor canadensis (American beaver): 109699672
Entry
109699672         CDS       T04791                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04022  cGMP-PKG signaling pathway
ccan04141  Protein processing in endoplasmic reticulum
ccan04151  PI3K-Akt signaling pathway
ccan04211  Longevity regulating pathway
ccan04261  Adrenergic signaling in cardiomyocytes
ccan04668  TNF signaling pathway
ccan04728  Dopaminergic synapse
ccan04911  Insulin secretion
ccan04915  Estrogen signaling pathway
ccan04918  Thyroid hormone synthesis
ccan04925  Aldosterone synthesis and secretion
ccan04926  Relaxin signaling pathway
ccan04927  Cortisol synthesis and secretion
ccan04928  Parathyroid hormone synthesis, secretion and action
ccan04934  Cushing syndrome
ccan04935  Growth hormone synthesis, secretion and action
ccan05020  Prion disease
ccan05030  Cocaine addiction
ccan05031  Amphetamine addiction
ccan05034  Alcoholism
ccan05161  Hepatitis B
ccan05163  Human cytomegalovirus infection
ccan05166  Human T-cell leukemia virus 1 infection
ccan05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109699672 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109699672 (Atf6b)
   04022 cGMP-PKG signaling pathway
    109699672 (Atf6b)
   04151 PI3K-Akt signaling pathway
    109699672 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    109699672 (Atf6b)
   04915 Estrogen signaling pathway
    109699672 (Atf6b)
   04926 Relaxin signaling pathway
    109699672 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    109699672 (Atf6b)
   04918 Thyroid hormone synthesis
    109699672 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    109699672 (Atf6b)
   04925 Aldosterone synthesis and secretion
    109699672 (Atf6b)
   04927 Cortisol synthesis and secretion
    109699672 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109699672 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    109699672 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    109699672 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109699672 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    109699672 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    109699672 (Atf6b)
   05031 Amphetamine addiction
    109699672 (Atf6b)
   05034 Alcoholism
    109699672 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109699672 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109699672 (Atf6b)
   05161 Hepatitis B
    109699672 (Atf6b)
   05163 Human cytomegalovirus infection
    109699672 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccan03000]
    109699672 (Atf6b)
Transcription factors [BR:ccan03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    109699672 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 109699672
NCBI-ProteinID: XP_020040096
LinkDB
Position
Unknown
AA seq 721 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGVRNSPLYPGLDEVAEEQMQLFRCVEQDVPFDS
SSVDVGMDTSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPCRQAPGVGE
VLRVKTESLAPPLCLLGDDPTSPFETVQITVGPTSDDPSDIQTKVEPVSPSSSVNSEASL
LSADSPSQAFTGEEVLEVKTESPSPPGCLLWDVSAPSRGAVQISMVPSPDSSSGKAPLIR
KPPLQPKPVVLTTVQMPSRAVPPSTTVLLQPLVQQPTGPPVVLIQGAIRVQPEGPSPAVP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
PAPVSPRMSREEPRPQRHLLEFSEQDPVHGVEPFQGSFQAPEEPQPSPTGHPSFRNLTAF
AGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPQRAQERQPL
QILRSFSFQKSQLRKRLPPVKSVPTQPLGPPERDAVGQLQLYRHPDRSQPEFLDAIDRRE
DTFYVVSFQRPGLSAPQDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEM
MQIECEVMDTRVIHIKTSTVPPSLRKQRSPTPGNATGGPLPASAASPAHQASHQPLYLNH
P
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagatcgcggacccgacgcgtttcttcaccgacaac
ctgctgagcccggaggactggggtgtgcgaaacagccccttgtaccctggcctggatgaa
gtggctgaggagcagatgcagctctttcgttgcgtggagcaggatgtcccgtttgacagc
agctctgtggatgtggggatggataccagtcctcctgaacccccgtgggaccctctgcct
atcttcccagatcttcaggtgaagtctgagccatcctccccctgttcttcctcctccctc
agctctgaatcatcacatctctccacagaaccctgcagacaagcacctggagttggggag
gtgctgcgtgtgaagacagaatccttagcacccccactctgtctcctgggagatgatcca
acatccccttttgaaaccgtgcagatcacagtgggtcccacctctgatgacccttcagat
attcagaccaaggtagagcctgtctctccatcttcctctgtcaactctgaggcctccttg
ctatcagcagattctcccagccaggcttttacaggagaggaggttctggaagtgaagaca
gagtccccatcccctccagggtgcctcctatgggatgtctcagccccctcacgtggagct
gtccagatcagcatggttccatcccctgatagttcctcaggcaaagccccactcatccgg
aagccaccactgcagcccaaacctgtggtgctaaccactgtccagatgccatccagagct
gtgcctccaagcaccaccgttcttctacagcccctcgtccagcagcccacagggccccca
gttgtcctcatccaaggtgctattcgagtccaacctgaagggccatcccctgctgttcca
cgacctgagaggaagagcattgttccagcccctatgcctgggaactcctgcccacctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaacagagagtctgcatgc
cagtcccggaggaagaagaaagagtatctgcagggactggaggccagactgcaggcagtg
ctggctgacaaccaacagctgcgcagggagaatgctgccctccggcggcgactggaggca
ctgctagctgagaacagcgagctcaagttagggtctggaaacaggaaagtggtctgcatc
atggtcttccttctcttcattgccttcaactttggacctgttagcatcagtgagcctcct
ccagctcctgtctctcctcggatgagcagggaggagcctcgaccccagagacatttgctg
gaattctcagagcaagatccagttcatggagttgaacccttccaggggtcctttcaggcc
cctgaggagcctcagccaagccccacaggtcatcccagtttcaggaacctgacagccttc
gctgggggtgccaaagagttactactgagagacctagaccagcttttcctctcctctgac
tgccggcacttcaaccgaactgagtccctgaggctcgccgatgagttgagtggctgggtc
cagcgtcaccagagaggccgacggaaaatgcctcagagggcccaggagagacagcctctc
caaatccttagatccttctccttccagaagtctcagctacggaagaggttgcctccagtt
aagtcagtccccacccaacccctgggacctccagaaagggatgctgtgggccaactacag
ttatatcgccacccagaccgttcacagccagagttcttggatgcaattgaccgtcgggaa
gacacattttatgttgtctccttccaaaggcctggcctctctgctccccaggaccacttg
ctgctcccagccatcagccacaacaagacctccagacccaagatgtccctggtgatgcct
gccatggctcctaatgagaccctatcaggccggggggccccaggggactatgaggagatg
atgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacggtg
cccccctcgctccgaaaacagcggtccccaaccccgggcaatgccacaggtggccccttg
ccagcttctgcagccagcccagcccatcaggcctcccaccaacccctctacctcaatcat
ccctga

DBGET integrated database retrieval system