KEGG   Castor canadensis (American beaver): 109700293Help
Entry
109700293         CDS       T04791                                 

Gene name
Tspan5
Definition
(RefSeq) tetraspanin-5 isoform X1
  KO
K17345  tetraspanin-5
Organism
ccan  Castor canadensis (American beaver)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109700293 (Tspan5)
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109700293 (Tspan5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 109700293
NCBI-ProteinID: XP_020041005
LinkDB All DBs
Position
Unknown
AA seq 268 aa AA seqDB search
MSGKHYKGPEVSCCIKYFIFGFNVIFWFLGIAFLGIGLWAWNEKGVLSNISSITDLGGFD
PVWLFLVVGGVMFILGFAGCIGALRENTFLLKFFSVFLGIIFFLELTAGVLAFVFKDWIK
DQLYFFINNNIRAYRDDIDLQNLIDFTQEYWQCCGAFGADDWNLNIYFNCTDSNASRERC
GVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQFEKWLQDNLTIVAGIF
IGIALLQIFGICLAQNLVSDIEAVRASW
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggaagcactacaagggtcctgaagtcagttgttgcatcaaatacttcattttt
ggcttcaatgtcatattttggttcttgggaatagcgtttcttggaattggactgtgggcg
tggaatgaaaaaggagttctgtccaacatctcttccatcactgatcttggtggctttgac
ccagtgtggctcttcctcgttgtgggaggagtaatgttcattttgggatttgcagggtgc
attggagcactgcgggaaaacactttccttctcaagtttttttctgtgttcctgggaatt
attttcttccttgagctcactgctggggttttggcatttgttttcaaagactggatcaaa
gaccagctatatttctttataaacaacaacatcagagcatacagagatgacattgatttg
caaaacctcatagacttcacccaggaatattggcagtgctgtggggcttttggagctgat
gattggaacctaaatatttacttcaattgcacagattccaatgcaagtcgagagcgatgt
ggcgtgccattctcctgctgtactaaagaccccgcggaagatgtcatcaacactcagtgt
ggctatgatgccaggcaaaaaccagaagttgaccaacagattgtaatctacacgaaaggc
tgtgtaccgcagtttgagaagtggctacaggataatttaaccatcgtggctggtattttc
ataggcattgcattgcttcagatttttgggatatgtctggcccagaatttggtgagtgac
atcgaagctgtcagggcgagctggtag

DBGET integrated database retrieval system