KEGG   Castor canadensis (American beaver): 109700730Help
Entry
109700730         CDS       T04791                                 

Gene name
Gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109700730 (Gpd2)
Enzymes [BR:ccan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     109700730 (Gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 GIDA FAD_oxidored EF-hand_8 EF-hand_5 Pyr_redox_2 EF-hand_9 HI0933_like NAD_binding_8 EF-hand_10 Pyr_redox Pyr_redox_3 Thi4 FAD_binding_3 EF-hand_4 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 109700730
NCBI-ProteinID: XP_020041629
LinkDB All DBs
Position
Unknown
AA seq 729 aa AA seqDB search
MAFQKAVKGTVLVGGGALATVLGLSQFTHYRRKQVNLAYVEAAECFAEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKECVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDATAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDSPTD
ITPHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSEDTQSISRNH
VVDISESGLVTIAGGKWTTYRSMAEDTVNAAIKVHNLKAGPSKTVGLYLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWSEAKKQEELETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGLSR
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtaaaagggaccgttcttgttggaggaggtgccctggccact
gtgttaggactctctcagtttactcattacagaaggaagcaagtgaacctggcctatgtg
gaagcagcagaatgctttgctgagcctgttaacagggagcctccttccagagaagctcag
ctactgactttgcaaaacacgtctgaatttgacatccttgttattggaggaggagcaaca
ggctgtggctgtgccctggatgccgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatcttcagaaggccatcatgaagttggatattgagcagtatagaatggtaaaagaagcc
cttcacgagcgtgccaacctactagaaattgctccccatttatcagctcctttgcctata
atgcttccggtttacaagtggtggcagttaccttactactgggtaggaatcaagctatat
gatctggttgcaggaagtaattgcctgaaaagcagttacgtcctcagcaaatcaagagcc
ctcgagcatttccccatgctccagaaggacaaactggtaggagcaattgtctactatgat
ggacaacacaatgatgcacggatgaaccttgccattgccctcactgctgccaggtatggg
gctgccacagccaattacatggaggtagtgagcttgctcaagaagacagacccccaaaca
gggaaagagtgtgtgagtggtgcacggtgcaaggatgtccttacagggcaggaatttgat
gtgagagccaaatgtgttatcaatgcgacgggacctttcacagactctgtgcgcaaaatg
gatgataaggacgccacggctatctgccagccgagtgctggggtccatattgtcatgccc
ggttactacagcccggagagcatgggacttcttgatccagcaaccagtgatgggcgagtt
attttcttcttaccctggcaaaagatgacaattgctggcaccactgatagtccaacggat
atcacaccacatcccattccttcagaagaagatatcaacttcattctgaatgaagtgcgt
aactacctgagctgtgatgttgaagtgagaagaggggacgtcctggcagcctggagtggt
atccgcccccttgttacagatcccaagtctgaagatacccagtccatctcccgaaaccat
gttgtggacatcagtgagagtggcctcgtcacaatagcaggcgggaagtggacaacgtac
cggtccatggcagaagacacggtgaatgctgccatcaaggttcacaatttgaaagcagga
ccaagtaagacagttgggctttaccttcaaggaggcaaagattggagtcccacactgtac
atcaggctggtccaggattacggactcgaaagtgaggtggcacagcacctggctgccacg
tatggtgacaaggcttttgaggtggccaaaatggcaagtgtgactggaaaaaggtggcct
attgttggagtacgtcttgtgtcagaatttccatatattgaagcagaggtgaaatacggg
attaaggagtacgcctgcactgcggtggacatgatatcccgccgcacccgcctagccttc
ctcaatgtccaggcggcggaggaagccctgcccaggattgttgagttgatgggcagagag
ctgaattggagtgaggctaagaaacaggaagaacttgaaacagccaggaagtttctatat
tatgaaatgggctataaatctcgatcagaacagttgacagatcgctctgaaattagccta
ctgccttcagacattgacagatataagaagagatttcataagtttgatgcagaccaaaaa
ggctttattacaattgttgatgttcagcgtgtattagagagtatcaatgtgcaaatggat
gaaaatacactacatgagattctgaatgaagtagatttgaacaaaaatggacaagtggag
ctcaatgaatttttgcagctaatgagtgctattcagaaaggaagagtgtctggaagccgc
cttgctatactcatgaaaactgcagaagaaaaccttgatcgaagagttccaattccagtg
gaccggagttgtggaggattatcgagataa

DBGET integrated database retrieval system