KEGG   Castor canadensis (American beaver): 109701269
Entry
109701269         CDS       T04791                                 

Gene name
Cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01522  Endocrine resistance
ccan04012  ErbB signaling pathway
ccan04066  HIF-1 signaling pathway
ccan04068  FoxO signaling pathway
ccan04110  Cell cycle
ccan04151  PI3K-Akt signaling pathway
ccan04933  AGE-RAGE signaling pathway in diabetic complications
ccan04934  Cushing syndrome
ccan05162  Measles
ccan05165  Human papillomavirus infection
ccan05169  Epstein-Barr virus infection
ccan05200  Pathways in cancer
ccan05202  Transcriptional misregulation in cancer
ccan05203  Viral carcinogenesis
ccan05206  MicroRNAs in cancer
ccan05215  Prostate cancer
ccan05220  Chronic myeloid leukemia
ccan05222  Small cell lung cancer
ccan05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109701269 (Cdkn1b)
   04066 HIF-1 signaling pathway
    109701269 (Cdkn1b)
   04068 FoxO signaling pathway
    109701269 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    109701269 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109701269 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109701269 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    109701269 (Cdkn1b)
   05206 MicroRNAs in cancer
    109701269 (Cdkn1b)
   05203 Viral carcinogenesis
    109701269 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    109701269 (Cdkn1b)
   05220 Chronic myeloid leukemia
    109701269 (Cdkn1b)
   05215 Prostate cancer
    109701269 (Cdkn1b)
   05222 Small cell lung cancer
    109701269 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109701269 (Cdkn1b)
   04934 Cushing syndrome
    109701269 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    109701269 (Cdkn1b)
   05169 Epstein-Barr virus infection
    109701269 (Cdkn1b)
   05165 Human papillomavirus infection
    109701269 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109701269 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109701269
NCBI-ProteinID: XP_020042331
UniProt: A0A250YC13
LinkDB
Position
Unknown
AA seq 199 aa
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVNHEELTRDLEKHRRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQEGQDVSGSRQAVPLVG
SQANSEDTHLVDQKTDPSASQTGLAEQCAGIRKRPATDESSTQNKRANRTEENVSDGSAN
AGSVVEQTPKKPGLRRRQT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctagagcggatggacgccaggcag
gcggagcaccccaagccctccgcctgcagaaacctcttcggcccggtgaatcacgaagag
ttgacccgggacttggagaagcaccgcagagacatggaagaagcaagccagcgcaagtgg
aatttcgatttccagaatcacaagcctttggagggcaaatacgagtggcaggaggtggag
aagggcagcttacccgagttctactacagacccccgcggccccccaaaggcgcctgcaag
gtgccagcgcaggagggccaggatgtcagcgggagccgccaggcggtgcctttagtgggg
tctcaggcaaactcagaggacacgcacttggtagaccaaaagactgacccgtcagccagc
cagacgggcttggcggagcagtgcgccgggataaggaagcgacctgccaccgacgagtct
tctactcaaaacaaaagagccaacaggacagaagaaaatgtttcagacggttccgctaat
gccggttctgtggtggagcagacacccaagaagccgggtctccgcagacgtcaaacgtaa

DBGET integrated database retrieval system