KEGG   Castor canadensis (American beaver): 109701504
Entry
109701504         CDS       T04791                                 

Gene name
Tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan04010  MAPK signaling pathway
ccan04012  ErbB signaling pathway
ccan04014  Ras signaling pathway
ccan04151  PI3K-Akt signaling pathway
ccan04915  Estrogen signaling pathway
ccan05200  Pathways in cancer
ccan05210  Colorectal cancer
ccan05211  Renal cell carcinoma
ccan05212  Pancreatic cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05223  Non-small cell lung cancer
ccan05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109701504 (Tgfa)
   04012 ErbB signaling pathway
    109701504 (Tgfa)
   04014 Ras signaling pathway
    109701504 (Tgfa)
   04151 PI3K-Akt signaling pathway
    109701504 (Tgfa)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109701504 (Tgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109701504 (Tgfa)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109701504 (Tgfa)
   05212 Pancreatic cancer
    109701504 (Tgfa)
   05225 Hepatocellular carcinoma
    109701504 (Tgfa)
   05214 Glioma
    109701504 (Tgfa)
   05211 Renal cell carcinoma
    109701504 (Tgfa)
   05215 Prostate cancer
    109701504 (Tgfa)
   05223 Non-small cell lung cancer
    109701504 (Tgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109701504 (Tgfa)
SSDB
Motif
Pfam: EGF TMEM154 CitMHS
Other DBs
NCBI-GeneID: 109701504
NCBI-ProteinID: XP_020042634
UniProt: A0A250XVC8
LinkDB
Position
Unknown
AA seq 159 aa
MVTSAGQLALFALGIVLAVCQALENTTSPLSDPPVAAAVVSHFNECPDSHTQFCFHGTCR
FLVQEDEPACVCHTGYIGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctgttcgcgctgggtatcgtgttggctgtgtgc
caagccctagagaacaccacatcccccctgagcgacccacctgtggctgcagctgtggtg
tcacactttaacgaatgcccagattcccacactcagttctgcttccatggaacctgcagg
tttttggtacaggaggacgagccagcatgtgtctgccacactggctacatcggtgcacgc
tgtgagcatgcagacctcctggctgtggtggccgccagccagaagaagcaggccatcact
gccttggtggtggtctccattgtggccctggctgtcctcatcatcacatgtgtgctgata
cactgctgccaagtccgaaaacactgtgagtggtgccgtgccctcatctgccggcacgag
aagcccagtgccctcctgaagggcaggactgcttgctgccactcagagacagtggtctga

DBGET integrated database retrieval system