KEGG   Castor canadensis (American beaver): 109702274
Entry
109702274         CDS       T04791                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor alpha-like
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan01521  EGFR tyrosine kinase inhibitor resistance
ccan04010  MAPK signaling pathway
ccan04014  Ras signaling pathway
ccan04015  Rap1 signaling pathway
ccan04020  Calcium signaling pathway
ccan04072  Phospholipase D signaling pathway
ccan04144  Endocytosis
ccan04151  PI3K-Akt signaling pathway
ccan04510  Focal adhesion
ccan04540  Gap junction
ccan04630  JAK-STAT signaling pathway
ccan04810  Regulation of actin cytoskeleton
ccan05163  Human cytomegalovirus infection
ccan05200  Pathways in cancer
ccan05206  MicroRNAs in cancer
ccan05214  Glioma
ccan05215  Prostate cancer
ccan05218  Melanoma
ccan05230  Central carbon metabolism in cancer
ccan05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109702274
   04014 Ras signaling pathway
    109702274
   04015 Rap1 signaling pathway
    109702274
   04630 JAK-STAT signaling pathway
    109702274
   04020 Calcium signaling pathway
    109702274
   04072 Phospholipase D signaling pathway
    109702274
   04151 PI3K-Akt signaling pathway
    109702274
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109702274
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109702274
   04540 Gap junction
    109702274
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109702274
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109702274
   05206 MicroRNAs in cancer
    109702274
   05230 Central carbon metabolism in cancer
    109702274
   05231 Choline metabolism in cancer
    109702274
  09162 Cancer: specific types
   05214 Glioma
    109702274
   05218 Melanoma
    109702274
   05215 Prostate cancer
    109702274
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109702274
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109702274
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccan01001]
    109702274
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ccan04090]
    109702274
Enzymes [BR:ccan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109702274
Protein kinases [BR:ccan01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109702274
CD molecules [BR:ccan04090]
 Proteins
  109702274
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set ig Ig_2 Pkinase Herpes_gE Ig_5 C2-set_2 DUF3475
Other DBs
NCBI-GeneID: 109702274
NCBI-ProteinID: XP_020043255
LinkDB
Position
Unknown
AA seq 827 aa
MGTSRQAFLVFGCLLTGMPSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQY
PMSVEEDPKVEIRNEENNSGLFVTVLEVVGASAAHTGLYTCYYNHTQTEENEVEGRGIYI
YVPDPDVAFVPLGMTDYLIIVEEDDSAVIPCRTTDPETPVILRNSDXLVPASYDSRQGFN
GTFSXGPYICEATVKGRKFQTIPFNVYALKGTSHLTVQMEALKTVYKSGETIMLTCAVXN
NEVVDLKWKYPGEVXKGKGITKLEEIKVPSIKLVYTLTVPEATVKDSGDYECTARQALTE
VKEMKKVTISVHEKGFVEIKPTFGQLEAVNLHEVRHFVVDVQAYPPPRISWLKDNSTLIE
NLTEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDMRSYTFELLTQVPSSIL
ELVDDHHGSGGGQTVRCTAEGVPLPDIEWMICKDIKKCSNETSWTILANNVSNIITEIHP
RDGSTVEGRVTFAKVEETIAVRCLAKNLLGSGNRELKLVAPTLRSELTVAAAVLVLLVIV
IISLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRI
LGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIV
NLLGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTR
SYVILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKAVLDSEV
KNLLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNVSSKHGELFRCN
NT seq 2484 nt   +upstreamnt  +downstreamnt
atggggacgtcccgccaggccttcctggtcttcggctgtctcctcacaggtatgccgagc
ctaatcctctgccagctctcattaccctctatccttccaaatgaaaatgaaaaggttgtg
cagctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtac
cccatgtctgtagaagaggaccccaaagtggaaatcagaaatgaagagaacaacagtggc
ctttttgtgacagtgctggaagtggtcggggcctcggcagcccacactggattgtacact
tgctattacaaccacacgcagacagaagaaaatgaagttgagggaaggggtatttatatc
tatgtgcccgacccagatgtggctttcgtgcccctagggatgacagattatttaatcatc
gtggaggaagatgattctgcagtcataccttgtcgcaccacggatccagagactcctgta
atcttacgcaacagtgatnggctggtgccagcctcctatgacagcaggcagggcttcaat
ggcaccttcagtngtgggccctacatctgtgaggccactgtcaaagggaggaagtttcag
accatcccatttaatgtctacgctttgaaaggtacatcccaccttactgtacaaatggag
gctcttaaaactgtgtacaagtcaggggaaacgatcatgctcacctgtgctgtcnttaac
aatgaggtggttgacctaaagtggaagtaccctggagaagtgtagaaaggcaaaggcatc
acgaagctggaggaaatcaaagtcccatccatcaaattggtgtacactttgacggtcccc
gaggccacggtgaaagacagtggagattacgaatgtactgcccgccaggcccttacggag
gtcaaagaaatgaagaaagtcaccatttctgtccatgagaaagggttcgttgagatcaaa
cccacctttggccagttggaagctgtcaacctgcatgaagtcagacactttgtggtggat
gtgcaggcctatccccctcccaggatatcctggctgaaagacaactcaactcttattgaa
aatctcaccgagatcacaactgatgtggaaaagattcaggagataaggtatcggagcaaa
ttaaagctcatccgtgctaaggaggaagacagtggccactatacaattgtagttcaaaat
gaagatgatatgaggagctatacttttgaactgttaactcaagttccctcatccattctg
gagctagtcgatgaccaccatggctctggtgggggacagactgtgaggtgcacagctgaa
ggcgtacctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtagtaat
gagacttcatggacaattttagctaataatgtctcaaatatcatcacggagatccacccc
cgagatgggagtactgtggagggccgagtgacatttgccaaagtggaggagacaattgca
gttcgatgcctggctaagaatctccttggatctgggaaccgagagctgaagctggtggcc
cccaccctgcgttctgaactcactgtggcagccgcagtcctggtgctgttggtgattgtg
atcatctcacttattgtcctggttgtcatttggaagcagaaaccaaggtatgaaattcgc
tggcgggtcattgaatcaattagccccgatggacatgaatatatttatgtggacccgatg
cagctgccttatgactcgagatgggagtttccaagagatggactagtgcttggtcggatc
ttgggatctggtgcatttgggaaagtggttgaaggaacagcctatggattaagccggtcc
cagcctgtgatgaaggtagcggtgaagatgctcaaacccacagccaggtccagtgagaaa
caagctctcatgtctgagctgaaaataatgactcacctggggccccatttaaacatcgtg
aacttgctgggagcctgtacgaagtcaggccccatttacatcatcactgagtactgcttc
tatggggatttggtcaactatttgcataagaatagggatagcttcttgagccaccaccca
gaaaagccgaagaaagagctggacatctttggattgaacccagctgatgagagcacacgg
agttacgtgattttgtcttttgaaaacaatggtgactacatggacatgaagcaagctgac
accactcagtatgtgcccatgctagaaaggaaagaggtctctaagtattcagacatccag
agatcactgtacgatcgtccagcctcgtataagaagaaagctgtgttagactcggaagtc
aaaaacctcctttcagatgataactcagaaggccttactttgttggatttgttgagtttc
acctatcaagttgcccgaggaatggaattcttggcttcaaaaaatgtaagttcaaagcat
ggagaactttttagatgcaactaa

DBGET integrated database retrieval system