KEGG   Castor canadensis (American beaver): 109703262Help
Entry
109703262         CDS       T04791                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ccan  Castor canadensis (American beaver)
Pathway
ccan04614  Renin-angiotensin system
ccan04924  Renin secretion
ccan05142  Chagas disease (American trypanosomiasis)
ccan05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:ccan00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    109703262
   04614 Renin-angiotensin system
    109703262
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109703262
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    109703262
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccan01002]
    109703262
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccan04147]
    109703262
   04090 CD molecules [BR:ccan04090]
    109703262
Enzymes [BR:ccan01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109703262
Peptidases [BR:ccan01002]
 Metallo Peptidases
  Family M2
   109703262
Exosome [BR:ccan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109703262
CD molecules [BR:ccan04090]
 Proteins
  109703262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 109703262
NCBI-ProteinID: XP_020043988
LinkDB All DBs
Position
Unknown
AA seq 1306 aa AA seqDB search
MGAASGPRGPRPPLLLLSLLLLPLPPALALDPGLQPGNFSADEAGAQLFADSYNSSAEQV
LFQSTAASWAHDTNITDENARRQEEAALLSQEFTEAWGQKAKELYEAIWQNFTDTKLQRV
IGAVRTLGPANLPLAKREQYNSLLSNMSRIYSTGKVCFPNKTATCWSLDPELTNILASSR
SYAMLLFAWEGWHNAVGIPLKPLYEDFTALSNEAYTQDGFSDTGAYWRSWYDSPTFEEDL
EHLYHQLEPLYLNLHAYVRRALHRHYGDRYINLRGPIPAHLLGNMWAQSWDNIYDMVVPF
PDKPNLDVTSTMVQKGWNATHMFRVAEEFFTSLGLSPMPPEFWAESMLEKPSDGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHVQYYLQYKDLPVSLRRGANPGFHEAI
GDVLALSVSTPAHLYKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPTSRYNFDWWYLRTKYQGICPPVVRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HQALCKEAGHQGPLHQCDIYQSTQAGAKLREVLQAGCSRPWQKVLKDLVGSDALDAQALL
NYFQPVSQWLQEQNQRNGEVLGWPEYQWHPPLPDNYPEGIDLITDEAEASKFVEEYDQTS
QVVWNEHAEANWNYNTNITTENSKILMQNSMKVANHTLKYGTWAKQFDVSNFQNAITKRI
IKKVQDLERAALPVHELEEYDQILLDMETTYSVATVCHTNGTCLQLEPDLVNVMATSRKY
EELQWVWKSWRDQVGRAILPFFPKYVELSNKAAQLNGYMDAGDSWRSMYETPSLEQDLEQ
LFQELQPLYLNLHAYVRRALHHHYGPQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
ALKMDATEAMIKQGWTPKRMFEEADNFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNMEELVVVHHEMGHIQYFMQYKDLPVAFREGANPGFHEAIGD
VLALSVSTPKHLHSLNLLSSEGGDYEYDINFLMKMALDKIAFIPFSYLLDQWRWRVFDGS
ITKENYNLEWWNLRLKYQGLCPPVPRSQGDFDPGAKFHVPSSVPYIRYFVSFIIQFQFHE
ALCQAAGHQGALHKCDIYQSKEAGKLLADTMKLGFSKPWPEAMKLITGQPNMSASAMMNY
FKPLMDWLITENERHGEKLGWPQYDWTPNSARLEGSSPDSGLVNFLGMNLEPQQARVGQW
VLLFLGVALLVATLGLTQRLCSIRRHSLHQSHRGPQFGSEVELRHS
NT seq 3921 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcttccggcccgaggggaccgcggccgccgctgctgctgctgtcactgttg
ctgctgccgctgccacccgccctggcgctggacccgggactgcagcccggcaacttttcc
gcagacgaggccggggcgcagctctttgcggacagctacaactcgagcgccgagcaggtg
ctgtttcagagcacggccgccagctgggcgcatgacaccaacatcaccgacgagaatgct
cggcgccaggaggaagcagccctgctcagccaggagtttacagaggcctggggccagaag
gccaaggagttgtacgaggcaatctggcagaacttcaccgacacaaagctgcagagggtc
atcggagctgtgcgcaccctgggacctgccaacctgcctctggccaagcgggaacagtac
aactctctgttaagcaacatgagtaggatctactccaccggcaaggtctgcttccccaac
aagactgccacctgctggtccctggacccagagctcaccaacatcctggcctcctcacga
agctatgccatgttgctgtttgcctgggagggctggcacaatgctgtgggcatcccattg
aaacccctatacgaagacttcactgccctcagcaacgaggcctacacgcaagatggcttc
tctgacacaggggcttactggcgctcctggtatgactcacctacctttgaggaggacctg
gagcacctctaccatcaattagagcccctttacctgaacctccatgcctatgtccgccgt
gcactgcatcgccactatggagacagatacatcaacctcagggggcccatccctgctcat
ctgctgggaaacatgtgggcccagagttgggacaatatctatgacatggtggtgcctttc
ccagataagcccaacctcgatgtcaccagtactatggtacagaagggctggaacgctaca
cacatgttccgggtggcagaggaattcttcacctccctggggctctcacccatgcctcct
gagttctgggcagaatcgatgctggaaaagccatctgacgggcgggaggtcgtgtgccat
gcctcagcctgggacttctacaacaggaaggacttcaggatcaagcagtgcacacgagtc
acgatggaccagctatctacagtgcaccacgagatgggccacgtgcagtactacctgcag
tacaaagacctgcccgtctccctgcgcagaggcgccaaccctggcttccacgaggccatt
ggggatgtcctggctctctcagtctccactcctgcacatctttacaaaataggcttgctg
gaccatgtcaccaatgacacagaaagtgacatcaattacttgctaaagatggcactagag
aaaattgccttcctgccctttggctacctggtggaccagtggcgctggggggtcttcagt
ggacggacacccacctcccgctacaactttgactggtggtatcttcgaaccaagtatcag
gggatctgtcctccagttgtccgtaatgaaacccactttgatgccggagccaagtttcac
gtaccaaatgtgacaccatatatcaggtattttgtaagttttgtcctgcagttccagttc
caccaagccctatgcaaggaggcaggccaccagggcccactgcaccagtgtgacatctac
cagtctacccaggcgggggccaaactccgggaggtgctgcaggcaggctgctccaggccc
tggcagaaggtgctgaaggatctggtgggctcagatgccttggatgctcaagcactgctt
aactacttccagccagtcagccagtggctgcaggagcagaaccagcggaatggcgaggtc
ctgggctggccagagtatcagtggcacccaccattgccagacaactacccagagggcatc
gacctgataaccgatgaagctgaggctagcaagttcgtggaagagtatgatcagacatcc
caggtggtgtggaatgaacacgcagaggccaactggaactacaacaccaacatcaccacg
gagaatagcaagatcctgatgcagaacagcatgaaggtagccaaccacactctgaagtat
ggcacctgggccaagcagtttgatgtgagcaatttccaaaatgccatcaccaagcggatc
ataaagaaggttcaagacctggaaagagcagcgctgcctgtccacgagctagaggagtac
gaccagatccttctggacatggagaccacttacagtgtggccactgtgtgccacacgaat
ggcacttgcctacagctggagcctgatctggtaaatgtgatggccacatccaggaagtat
gaagaactgcagtgggtctggaagagctggagagaccaggtggggagagccatcctccct
tttttcccgaagtacgtggaactcagcaacaaggccgcccagctcaatggctacatggat
gcaggggactcatggagatctatgtatgagacgccatccctggagcaagacctggagcag
ctcttccaggagctgcagccactgtacctgaacctgcatgcctatgtgcgccgtgccctg
catcaccactatgggccccagcacatcaacttggagggccccattcctgcccaccttctg
ggcaacatgtgggcacagacctggtccaatatctatgacttggtggtacccttcccttca
gccctcaagatggatgccacggaggccatgataaagcagggctggacacccaaaagaatg
tttgaggaagctgacaatttctttacctcccttgggctgctgcctgtgccccctgagttc
tggaacaagtcaatgctggagaagccgactgatgggcgggaggtggtgtgccacgcctca
gcctgggacttctacaatggcaaggacttcaggatcaagcagtgcaccacggtgaacatg
gaggagctggtggtggtccaccatgaaatggggcacatccagtatttcatgcagtacaag
gacttgcctgtggcctttcgggagggcgccaaccctggctttcacgaagccattggggat
gtgctggccctctcagtgtctacccccaagcacctacacagcctcaacctcctgagtagt
gagggtggtgactatgagtatgacatcaactttctgatgaagatggccctcgacaagatt
gcctttatccccttcagctacctcctcgaccagtggcgctggagggtctttgatggaagc
atcaccaaggagaactacaacctagagtggtggaacctcaggctaaagtaccaaggtctc
tgccccccagtacccagatctcaaggtgactttgacccaggggccaagttccatgttcct
tcaagtgtgccttatatcagatacttcgtcagcttcatcatccagttccagttccatgag
gctttgtgccaggctgctggccaccagggtgccctgcacaagtgtgacatctaccagtcc
aaggaggcagggaagctcctggcggacaccatgaagctgggcttcagtaagccttggcca
gaagccatgaaactgatcacaggccagcctaacatgtcagcctcggccatgatgaactac
ttcaagccactgatggactggctcatcactgagaacgagcggcacggagagaagctgggc
tggccacaatatgactggacgccaaactccgctcgcttggaaggctcctccccagactcc
ggcctcgtcaacttcctgggcatgaacctggagccacagcaggcccgcgtgggccagtgg
gtgctgctgttcttgggtgttgccctgctggtagccaccttgggcctcacccaacgactc
tgcagcatccgccgtcacagcctccaccagtcccaccgtggcccccagttcggctctgag
gtggagctcagacactcctga

DBGET integrated database retrieval system