KEGG   Clavibacter michiganensis subsp. capsici: AES38_06350Help
Entry
AES38_06350       CDS       T05227                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ccap  Clavibacter michiganensis subsp. capsici
Pathway
ccap00473  D-Alanine metabolism
ccap00550  Peptidoglycan biosynthesis
ccap01100  Metabolic pathways
ccap01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AES38_06350
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AES38_06350
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AES38_06350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ccap01011]
    AES38_06350
Enzymes [BR:ccap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AES38_06350
Peptidoglycan biosynthesis and degradation proteins [BR:ccap01011]
 Precursor biosynthesis
  Amino acid ligase
   AES38_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 GARS_A AadA_C ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: ALD12590
UniProt: A0A0M5JS49
LinkDB All DBs
Position
1335691..1336800
Genome map
AA seq 369 aa AA seqDB search
MTERIRVVLLFGGTSSEHSISCATASGVLGAIDRERFEVIPVGITPRGAFTLQDDDAAAF
ALDADALPEVADNGTRVRWPEDASSRELRVRDADGSERSLGRVDLVFPILHGTQGEDGTV
QGMLELAGLPYVGSGVLASALGMDKHYAKTVLRAAGIQVAPWITVSRHEWAADPAGVRAR
AAELALPAFVKPARAGSSVGVSRVAEAAALDAALETAFREDDRVLVEAGLVGREVECAIL
DDGPGREPRASVAGEIVVSGRDFYDFEAKYLGADGIDLVCPADVTDAELAEMRELSIRAF
RAVDGRGLARVDFFLTADGFVLNEVNTMPGFTPISMFPACWQASGIAYPELISRLLDVAL
AWEADGARG
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcatccgggtcgtcctcctcttcggcggcacctccagcgagcactccatc
agctgcgccacggcgagcggcgtcctcggcgccatcgaccgcgagcgcttcgaggtgatc
cccgtggggatcacgccgcgcggcgccttcacgctccaggacgacgacgcggcggccttc
gcgctcgacgcggacgccctgcccgaggtggcggacaacggcacgcgcgtgcgctggccg
gaggacgcgtcctcccgcgagctccgggtccgggacgcggacggctccgagcgctcgctc
ggccgcgtcgacctcgtcttcccgatcctgcacggcacccagggcgaggacggcaccgtg
cagggcatgctcgagctcgccgggctgccgtacgtcggctcgggcgtgctcgcctcggcg
ctcggcatggacaagcactacgcgaagaccgtgctgcgcgcggcgggcatccaggtggcg
ccgtggatcacggtgtcccggcacgagtgggcggccgaccccgcgggcgtccgcgcccgg
gcggccgagctcgcgctcccggcgttcgtgaagcccgcgcgcgccggatccagcgtgggc
gtcagccgcgtggcggaggccgccgcgctcgacgccgccctcgagaccgcgttccgcgag
gacgaccgcgtgctcgtcgaggcgggcctcgtcggccgcgaggtcgagtgcgccatcctc
gacgacgggccgggccgggagccgcgcgcgtccgtcgcgggcgagatcgtcgtctcgggc
cgcgacttctacgacttcgaggccaagtacctgggcgcggacggcatcgacctggtctgc
ccggccgacgtcaccgacgcggagctcgccgagatgcgcgagctctcgatccgggcgttc
cgcgcggtcgacggccgcggcctcgcgcgcgtcgacttcttcctcacggcggacggcttc
gtgctcaacgaggtcaacacgatgccgggcttcacgcccatctccatgttcccggcctgc
tggcaggcgtccggcatcgcgtacccggagctcatctcgcggctcctcgacgtggcgctc
gcgtgggaggcggatggcgcccggggctga

DBGET integrated database retrieval system