KEGG   Clavibacter michiganensis subsp. capsici: AES38_09395Help
Entry
AES38_09395       CDS       T05227                                 

Definition
(GenBank) NADPH:quinone reductase
  KO
K00344  NADPH:quinone reductase [EC:1.6.5.5]
Organism
ccap  Clavibacter michiganensis subsp. capsici
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AES38_09395
Enzymes [BR:ccap01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     AES38_09395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Epimerase ELFV_dehydrog DapB_N
Motif
Other DBs
NCBI-ProteinID: ALD13102
UniProt: A0A0M5JWV9
LinkDB All DBs
Position
complement(1999978..2001006)
Genome map
AA seq 342 aa AA seqDB search
MRAITYTRTGSPDVLQPVDRDEAAPGPGEVRVRVVVSGVNPTDWKSRDGGSPGQELPFPE
VVPNQDGAGVIDAVGPDVTDLAVGDRVWIMLAAHGRPTGTAQEKTVLPVARVAPLPDGLS
FDLGASLGVPAVTAHRALTVSEDGPSRLAPGALAGKHVLVAGGAGAVGHAAIQLARWAGA
TVITTVSSPEKGALATAAGAQHVVDYKHGDAVAEIRSIAPDGVDLVVEVAPAQNAELNQA
VAKNRASVAVYANNGGDTVTLPVVDSFVKNLRYQFLLLYTVGQEALDAARADIHLALIDG
ALPVGEEAGLPITRFALEATADAHQAVEDGVTGKVLIDVTPA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgatcacctacacccgcaccggttcccccgacgtcctgcagcccgtcgaccgc
gacgaggccgcccccggccccggtgaggtgcgcgtccgcgtcgtcgtctccggcgtgaac
cccaccgactggaagtcgcgcgacggcggatcgcccggccaggagctcccgttccccgag
gtcgtcccgaaccaggacggcgcgggcgtcatcgacgccgtcggccccgacgtcaccgac
ctcgccgtcggcgaccgcgtctggatcatgctggccgcccacggccgccccaccggcacc
gcgcaggagaagacggtcctgcccgtcgcccgcgtcgcgcccctgcccgacggcctctcc
ttcgacctcggcgcgagcctcggcgtgccggccgtcaccgcgcaccgcgccctcaccgtc
tccgaggacggcccgtcgcgcctcgcgcccggcgccctcgccgggaagcacgtgctcgtc
gccggcggcgcgggcgcggtcggccacgcggccatccagctcgcgcgctgggccggcgcc
accgtgatcaccacggtcagctcgccggagaagggcgccctcgcgacggccgccggcgcg
cagcacgtcgtggactacaagcacggcgacgcggtggcggagatccggtccatcgcgccc
gacggcgtcgacctggtcgtggaggtcgcgcccgcgcagaacgccgagctcaaccaggcg
gtggcgaagaaccgcgcgtccgtcgcggtgtacgcgaacaacggcggcgacaccgtcacg
ctgcccgtcgtcgacagcttcgtgaagaacctgcgctaccagttcctgctgctctacacg
gtgggccaggaggcgctcgacgccgctcgcgcggacatccacctggcgctcatcgacggc
gccctgcccgtcggcgaggaggcgggcctgccgatcacccgcttcgcgctcgaggccacg
gcggacgcccaccaggcggtcgaggacggcgtgaccggcaaggtgctcatcgacgtgacg
cccgcctga

DBGET integrated database retrieval system