KEGG   Clavibacter michiganensis subsp. capsici: AES38_10105Help
Entry
AES38_10105       CDS       T05227                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ccap  Clavibacter michiganensis subsp. capsici
Pathway
ccap03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    AES38_10105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ccap03400]
    AES38_10105
Enzymes [BR:ccap01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AES38_10105
DNA repair and recombination proteins [BR:ccap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AES38_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALD13223
UniProt: A0A0M4HRF8
LinkDB All DBs
Position
2142153..2144654
Genome map
AA seq 833 aa AA seqDB search
MAGAKQQVEVEGRRITLTNLDKVLYPATGTTKGDVIAYYAAIAPHMLPHLRDRPVTRKRW
VDGVGTDDEPGKMFFQKDLDAHTPEWVQRRAIQHRDHANDYPLVADVATLTWLGQIAALE
LHVPQWRFGRTGDVRRPDRLVLDFDPGPGAGLPECVEVAGAARAILRDMGLEPYPVTSGS
KGIHLYAALDGSHDADAISEVAHELARALEADHPDLVVSDMRKALRHGKVLVDWSQNNPA
KTTVAPYSLRGRSRPTVAVPRTWRELASPTLRHLEMDEVVARMRRRQDPLAPVEEGHRES
LEPTPERLAGFARKEPADDRLATYRSKRDAAKTSEPVPAESPAPSEGRSFVIQEHHARAL
HWDFRLEHDGVLVSWALPKGVPTEHGTDHLAVQTEDHPVEYGAFEGTIPAGEYGGGEVTI
WDAGTYELEKWRDGKEVIATLHGRGSGTGIDGPRRYALIHTGGHGKADANWLIHLMEPAD
APAKAHARPARPAALERAGGRTRVGARRRGGAASAPAPMLATAATGAGLDPDEEWAVEMK
WDGYRAIAVVADGRATITSRNGVDLTPAFPELAELPDSLDVDAAVLDGEIVVLGDGGRPD
FGLLQTRLGLTGEKDVARARKAAPVHLMLFDALAIGDRVLVEEPYRERRAALLDAVRSPG
RGRIQVPPAFDGDLDGALATSRELGLEGVVAKRVDAPYESGRRSSAWLKVKHHRAQEVVV
GGWRPGSGSRASGVGSLLVGVPGPDGLDYAGRVGTGFTERDLADALRRFRPLARKTSPFA
DVPAADARDAHWITPRLVGEVEFAEWTSTGRLRQASWRGWRHDKSPDEVVRED
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgaagcagcaggtggaggtcgaggggcggcggatcacgctgacgaacctc
gacaaggtgctgtacccggccaccggcacgaccaagggcgacgtgatcgcgtactacgcg
gccatcgcgccgcacatgctgccgcacctccgcgaccggccggtgacccgcaagcgctgg
gtcgacggcgtcgggaccgatgacgagccggggaagatgttcttccagaaggacctcgac
gcccacacgccggagtgggtccagcggcgggcgatccagcaccgcgaccacgcgaacgac
taccccctcgtcgccgacgtcgcgacgctcacctggctcgggcagatcgcggcgctcgag
ctgcacgtgccgcagtggcgcttcggccgcacgggcgacgtgcgtcgccccgaccgcctc
gtgctcgacttcgacccgggacccggcgccggacttcccgagtgcgtcgaggtcgcgggg
gcggcccgcgcgatcctccgcgacatgggcctcgagccctacccggtgacgagcggatcc
aaggggatccacctctacgcggccctcgacggcagccacgacgcggacgccatctccgag
gtggcgcacgagctcgcccgcgcgctcgaggccgaccaccccgacctcgtcgtgagcgac
atgaggaaggcgttgcggcacggcaaggtgctcgtcgactggagccagaacaacccggcc
aagacgacggtggcgccgtactcgctgcgcggccgctcccggccgaccgtcgcggtgccg
cgcacgtggcgcgagctcgcgtcgccgaccctccggcacctggagatggacgaggtcgtc
gcgcggatgcggaggcgccaggatccgctcgcccccgtcgaggagggacaccgcgagagc
ctggagccgacgcccgagcggctcgcgggcttcgcacggaaggagccggccgacgaccgc
ctcgccacctaccgctcgaagcgcgacgcggccaagacgagcgagcccgtgcccgcggag
tccccggcgccgtcggagggccgctccttcgtgatccaggagcaccacgcccgcgcgctg
cactgggacttccggctggagcacgacggcgtgctcgtgagctgggccctccccaagggc
gtgcccaccgagcacggcacggaccacctcgcggtgcagaccgaggaccacccggtcgag
tacggcgcgttcgagggcacgatccccgcgggcgagtacggcggcggcgaggtgacgatc
tgggacgcgggcacctacgagctggagaagtggcgcgacggcaaggaggtcatcgcgacg
ctgcacggtcgaggctccggcaccggcatcgacgggccccggcggtacgcgctcatccac
acgggcgggcacggcaaggccgacgcgaactggctgatccacctgatggagcccgccgac
gcccccgcgaaggcgcacgcgaggcccgcacgccccgccgccctggagagggcgggaggg
cgcacgcgcgtcggcgcgcgacggaggggcggcgccgcatccgcccccgcgcccatgctc
gcgacggccgcgaccggcgccggcctcgaccccgacgaggagtgggccgtcgagatgaag
tgggacggctaccgcgcgatcgccgtcgtcgccgacggccgcgcgaccatcacgagccgc
aacggcgtcgacctcacgcccgccttccccgagctcgccgagctgcccgactccctcgac
gtcgacgcggccgtgctcgacggcgagatcgtcgtgctcggcgacggcggccgcccggac
ttcggcctcctgcagacgcgcctcgggctcaccggcgagaaggacgtcgcgcgcgcccgg
aaggccgcgcccgtgcacctcatgctcttcgacgccctcgcgatcggcgaccgcgtgctc
gtggaggagccgtaccgggagcgccgggccgcgctcctcgacgccgtccgctcgccgggc
cgcggccggatccaggtcccgcccgccttcgacggcgacctcgacggggcgctcgccacc
agccgcgagctcggcctcgagggcgtcgtcgccaagcgcgtcgacgcgccctacgagtcg
ggccgccgatccagcgcgtggctgaaggtcaagcaccaccgggcgcaggaggtcgtggtc
ggcggctggcgacccggatccggcagccgcgcatccggcgtcggctcgctgctcgtcggc
gtccccggccccgacggcctggattacgcgggccgcgtcggcacgggcttcaccgagcgc
gacctcgccgacgccctccgccgcttccgcccgctcgcgcggaagacgagccccttcgcc
gacgtgccggccgccgacgcccgcgacgcgcactggatcacgccccgcctcgtcggcgag
gtcgagttcgccgagtggacctccacggggcgcctccgccaggcgtcctggcgcggctgg
cggcacgacaagtcgcccgacgaggtcgtgcgcgaggactga

DBGET integrated database retrieval system