KEGG   Clavibacter michiganensis subsp. capsici: AES38_12235Help
Entry
AES38_12235       CDS       T05227                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ccap  Clavibacter michiganensis subsp. capsici
Pathway
ccap00020  Citrate cycle (TCA cycle)
ccap00480  Glutathione metabolism
ccap01100  Metabolic pathways
ccap01110  Biosynthesis of secondary metabolites
ccap01120  Microbial metabolism in diverse environments
ccap01130  Biosynthesis of antibiotics
ccap01200  Carbon metabolism
ccap01210  2-Oxocarboxylic acid metabolism
ccap01230  Biosynthesis of amino acids
Module
ccap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ccap_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ccap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AES38_12235
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AES38_12235
Enzymes [BR:ccap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AES38_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP ART-PolyVal
Motif
Other DBs
NCBI-ProteinID: ALD13582
UniProt: A0A0M4H0I1
LinkDB All DBs
Position
complement(2613775..2614989)
Genome map
AA seq 404 aa AA seqDB search
MEKIKVEGTVVELDGDEMTRIIWQSIKDTLIHPYLDIDLEYYDLGIEKRDETDDQITVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFREPIIISNIPRL
VPGWNKPIIVGRHAFGDQYRATDFRFEGEGTLTMTFTPKDGSEPQQFEVFQSPGSGVAMG
MYNLDDSIRDFARASLSYGLARNYPVYLSTKNTILKAYDGRFKDLFQEVFEAEYKEQFDA
AGLTYEHRLIDDMVAASLKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLTTPDGK
VVEAEAAHGTVTRHYRQHQQGKPTSTNPIASIYAWTRGLAHRAKLDGNDALATFADTLED
VVITTVESGKMTKDLALLVGPDQPYQTTEEFLASLADNLQARLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagatcaaggtagaggggaccgtcgtcgagctcgacggcgacgagatgacgcgc
atcatctggcagtccatcaaggacacgctcatccacccgtacctcgacatcgacctcgag
tactacgacctgggcatcgagaagcgcgacgagaccgacgaccagatcaccgtcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgccacgatcacgcccgacgag
gcgcgcgtcgaggagttcggcctgaagaagatgtggcgctcgccgaacggcaccatccgc
aacatcctgggcggcacgatcttccgcgagcccatcatcatcagcaacatcccgcgcctc
gtgcccggctggaacaagccgatcatcgtcggccgccacgcgttcggcgaccagtaccgc
gccaccgacttccgcttcgagggcgagggcacgctcacgatgaccttcacgccgaaggac
ggctcggagccgcagcagttcgaggtgttccagagccccggatccggcgtcgcgatgggc
atgtacaacctcgacgactcgatccgcgacttcgcgcgcgcgtcgctctcctacggcctc
gcccggaactacccggtgtacctctccacgaagaacacgatcctcaaggcctacgacggc
cgcttcaaggacctgttccaggaggtcttcgaggccgagtacaaggagcagttcgacgcc
gcgggcctcacctacgagcaccgcctcatcgacgacatggtcgccgcctcgctcaagtgg
gagggcggctacgtctgggcctgcaagaactacgacggcgacgtgcagtccgacaccgtg
gcccagggcttcggctcgctcggcctcatgacgagcgtgctcaccacccccgacggcaag
gtcgtcgaggcggaggccgcgcacggcacggtcacgcgccactaccgccagcaccagcag
ggcaagcccacgtcgacgaaccccatcgcgtcgatctacgcctggacgcgcggcctcgcg
caccgcgccaagctcgacggcaacgacgcgctcgcgacgttcgcggacaccctcgaggac
gtcgtcatcacgacggtcgagagcggcaagatgacgaaggacctcgcgctcctcgtcgga
ccggaccagccgtaccagacgaccgaggagttcctcgcgtcgctcgcggacaacctgcag
gcgcgcctggcctga

DBGET integrated database retrieval system