KEGG   Cyprinus carpio (common carp): 109046503
Entry
109046503         CDS       T05134                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
ccar  Cyprinus carpio (common carp)
SSDB
Motif
Pfam: Nore1-SARAH RA SR-25 Ras_bdg_2 DUF3446
Other DBs
NCBI-GeneID: 109046503
NCBI-ProteinID: XP_018919792
LinkDB
Position
43
AA seq 277 aa
MTDCERLDMTWGSSASSGYCSQSDSEHELEQFYTARTSLRKTKRRKEKDEPVDCRKQELS
LSEVQQKVKEYNAQVNSNLFMVLNRDGSYTGFIKVLFKLARPVSLPPPRSTSSSSSSSSS
SSGRDGSCREDKALKHRTSFYLPRDTVKHLHISSSTRAREVIEALLRKFTVVDNPAKFSL
FERSERHNQVYLRKLADDERPLFLRLCAGPNEKVLSLVLKENETGEVNWDAFSFPELQNF
LRILQREEEDHVRQIVRRYTLARDKMNEALKNFSTPG
NT seq 834 nt   +upstreamnt  +downstreamnt
atgacggactgcgagcgtttggacatgacatggggcagcagcgcgagcagcggatactgc
agccagagcgactccgagcacgagctcgagcagttttacaccgcgcgcacctcgctcaga
aagaccaaaagacgcaaggaaaaagatgagccagtggactgcaggaaacaggagctgtcc
ctcagtgaagtacaacagaaagtgaaagaatacaatgctcaggtcaacagtaacctcttc
atggttctgaaccgtgatggatcttacactggcttcataaaggtcctgttcaagctggcc
cggcccgtgtctctccctcctccacggagcacctcctcctcctcctcctcgtcctcctcc
tcctctggacgggatggcagttgtcgtgaagacaaagcactgaagcaccgcacctcattc
tacctgcccagagacacggtcaaacacctgcacatcagctccagcacgcgggccagagag
gtcatcgaagcactgctgaggaagttcaccgtggtggacaatccggccaagttctcacta
tttgaacgcagcgagcgacacaatcaagtgtacctaaggaagttagcagatgacgaacgt
ccacttttcctgcgcctgtgtgctggacccaacgagaaggtcctcagtttagttcttaaa
gagaatgaaacgggggaagtcaattgggatgcgttcagttttcctgaactccagaacttc
ctgcgcatcctgcagcgggaggaggaggatcacgtgcggcagatcgtgcggcgctacact
ctggccagagacaagatgaacgaagctctgaagaacttcagcacgccgggttga

DBGET integrated database retrieval system