KEGG   Cyprinus carpio (common carp): 109046504
Entry
109046504         CDS       T05134                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
ccar  Cyprinus carpio (common carp)
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2 Ribosomal_L6e
Other DBs
NCBI-GeneID: 109046504
NCBI-ProteinID: XP_018919793
LinkDB
Position
43
AA seq 270 aa
MRDCERFEMTWGSSASSGYCSQSDSEHELEQFYTARTSFRKTKKRKEKDELVDWRKPELS
VSEIQQKVKEYNAQVNSNLFMVLNRDGSYTGFIKVQFKLARPVSLPPPQITSSSSGRDGG
CREHKALKRGTSFYLPRDTVKHLHISSSTRAKEVIQALLKKFTVVDNPAKFSLFERSERQ
NQVYLRKLADDERPLFLRLCAGPNEKVLSLVLKENETGEVNWDAFSFPELQNFLRILQRE
EEDHVRQIVRRFALARDKMKEALENFSTPG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgagggactgcgagcggttcgagatgacgtggggcagcagcgcgagcagcggatactgc
agccagagcgactccgagcacgagctcgagcagttctacaccgcgcgcacgtcattcaga
aagaccaaaaaacgcaaggaaaaagatgaactagtggactggagaaaaccggagctgtct
gtcagtgaaatacaacagaaagtgaaagaatacaacgctcaggtcaacagtaacctcttc
atggttctgaaccgtgatggatcttacactggcttcataaaggtccagttcaagctggcc
cggcccgtgtctctcccccctccacagatcacgtcctcctcctcaggacgggatggaggt
tgtcgggaacacaaagcactgaagcgcggcacctcattctacctgcccagagacacggtc
aaacacctgcacatcagctccagcacacgggccaaagaggtcatccaagcactgctgaag
aagttcactgtggtggacaatccggccaagttctctctgtttgaacgcagcgagcgacag
aaccaagtgtatctaaggaagttagcagatgatgagcgtccacttttcctgcgtctgtgt
gctggacccaacgagaaggtcctcagtttagtccttaaagagaatgaaaccggggaagtc
aattgggatgcgttcagttttcctgagcttcagaacttcctgcgcatcctgcagcgcgag
gaggaggatcacgtgcggcagatcgtgcggcgcttcgctctggccagagacaagatgaaa
gaggctctggagaacttcagcacgccgggctga

DBGET integrated database retrieval system