KEGG   Cyprinus carpio (common carp): 109047224Help
Entry
109047224         CDS       T05134                                 

Gene name
stat3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04068  FoxO signaling pathway
ccar04217  Necroptosis
ccar04920  Adipocytokine signaling pathway
ccar04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109047224 (stat3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109047224 (stat3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109047224 (stat3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109047224 (stat3)
Transcription factors [BR:ccar03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109047224 (stat3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Spectrin
Motif
Other DBs
NCBI-GeneID: 109047224
NCBI-ProteinID: XP_018920468
LinkDB All DBs
Position
44
AA seq 821 aa AA seqDB search
MASQVAVGFVENNVSMAQWNQLQQLETRYLEQLYHLYSDSFPMELRQFLAPWIESQDWAY
AANKESHATLVFHNLLGEIDQQYSRFLQENNVLYQHNLRRIKQHLQSKYLEKPMEIARIV
ARCLWEEQRLLQTATTAQQDGQVAHPTGTVVTEKQQILEHNLQDIRKRVQDMEQKMKMLE
NLQDDFDFNYKTLKSAGELSQDLNGNSQAAATRQKMSQLEQMLSALDQLRRQIVTEMAGL
LSAMDFVQKNLTDEELADWKRRQQIACIGGPPNICLDRLETWITSLAESQLQIRQQIKKL
EELQQKVSYKGDPIIQHRPALEEKIVDLFRNLMKSAFVAERQPCMPMHPDRPLVIKTGVQ
FTTKVRLLVKFPELNYQLKIKVCIDKESGDVAAIRGSRKFNILGTNTKVMNMEESNNGSL
SAEFKHLTLREQRCGNGGRTNSDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVI
SNICQMPNAWASILWYNMLTNHPKNVNFFTKPPVGTWDQVAEVLSWQFSSTTKRGLTIEQ
LTTLAEKLLGPCVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGY
IMGFISKERERAILSPKPPGTFLLRFSESSKEGGITFTWVEKDINGKTQIQSVEPYTKQQ
LNSMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPEAQPDTEFPDPGCVI
QPYLKTKFICVTPCPSVFMDFPDSELLGNGFPGTNSGNTSDLFPMSPRTLDSLMHNEAAE
ANPGPLESLTLDMEMSSDHPSPMREVFAASTVSDMDTCRNA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtcaagttgcagttggttttgtggaaaacaatgtcagcatggcccagtggaac
cagttacagcagttggagacgcgctatttggagcagctgtatcatctgtacagtgacagc
ttccctatggagctgcggcagtttttggccccctggatcgagagccaggactgggcgtat
gcggccaacaaggagtctcatgccacgcttgtgttccataacctgctgggggagatcgat
cagcagtacagccgcttcctgcaggagaacaatgtcctgtaccaacacaacctgcggcgc
atcaagcagcacctgcagagcaagtatctagagaagcccatggagatcgcccgcatcgtg
gcccgctgcctgtgggaagagcagcgtctgctgcagacggccaccactgcacagcaggac
ggccaggttgcccatcccactggcactgtggtgacagaaaagcagcagatactggaacac
aacctgcaggatattaggaagagagtacaggatatggagcagaagatgaagatgttggaa
aatctgcaagatgattttgacttcaactacaaaactcttaaaagtgccggagagttgtcc
caggacctgaatggaaacagccaggcagcagccaccaggcagaagatgtctcagctagag
cagatgctgagtgctctggatcagctgaggaggcaaatagtgactgagatggcagggctg
ctgtctgccatggactttgtgcagaagaatctgacagatgaagaactggccgactggaag
aggaggcagcagattgcctgcatcggaggaccaccgaacatctgtctggaccgcttagag
acatggatcacctctttggctgagtcgcagctgcagataagacagcagatcaagaaactg
gaggagcttcaacagaaggtctcctacaaaggagatccgattattcagcaccgcccagct
ctggaggagaagatcgtagacctgttccgcaaccttatgaagagtgcgtttgttgcggag
aggcagccttgtatgcccatgcaccctgaccgaccacttgtcatcaaaacaggagttcag
ttcaccaccaaagtcaggttacttgtgaaattcccagagttgaattaccagctgaaaata
aaagtgtgtattgacaaggagtcaggtgacgtggcagccattcgaggttcacgaaaattc
aacatccttggcaccaacacgaaggtgatgaacatggaggaatccaacaatggcagcctg
tcagcagagttcaaacatctgactcttcgagagcagagatgtggcaatggaggccgaacc
aacagtgacgcgtctctgatagtgaccgaagaactgcacctgatcacgtttgagacagag
gtctaccaccaaggactaaagatcgaccttgagacacattctctcccagtggtggtcatc
tctaatatctgtcaaatgccaaacgcatgggcgtccatcctgtggtacaacatgctgacc
aaccatcccaagaatgtgaatttcttcaccaaacctccagtgggaacgtgggatcaggtg
gctgaggtgctcagctggcagttttcatccacaaccaagagaggacttaccatcgagcaa
ctcaccacgcttgcagagaaacttctgggtccttgtgtaaactactctggttgccagatc
acatgggccaagttctgcaaagaaaacatggcaggaaaagggttctcattctgggtgtgg
ctagacaacattatcgacctagtgaagaaatatattttggctctatggaatgaagggtat
attatgggcttcatcagtaaagaaagagagagggcaatcctgagcccaaagcctcctggg
acattcctgctgcgcttcagtgaaagcagcaaagagggaggcattaccttcacctgggtc
gagaaggacatcaatggtaagacccagatccagtcggttgaaccgtacactaagcagcaa
ctcaacagtatgtctttcgccgagatcatcatgggctacaagatcatggatgccaccaac
atcctggtctcgccgctggtctatctctaccctgatatccccaaggaggaggcgtttggc
aagtactgccgccccgaggcccagcctgacaccgaattccctgatcctggatgtgtaatt
cagccttacctgaagaccaagttcatctgtgtcaccccgtgtccttccgtcttcatggac
ttcccggacagtgagctgctcgggaacggcttccctgggactaactctggcaacacaagc
gatttgttcccaatgtcccctcgtacactcgactctctcatgcacaatgaagctgccgag
gccaacccaggaccactggaatctctcactctggacatggagatgagctctgatcatccc
tcgccaatgagagaagtgtttgcagcctcgacagtctcagatatggatacctgccgaaat
gcttag

DBGET integrated database retrieval system