KEGG   Cyprinus carpio (common carp): 109047554
Entry
109047554         CDS       T05134                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109047554
   04371 Apelin signaling pathway
    109047554
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109047554
   04137 Mitophagy - animal
    109047554
  09143 Cell growth and death
   04218 Cellular senescence
    109047554
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109047554
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109047554
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109047554
SSDB
Motif
Pfam: Ras Roc RsgA_GTPase GTP_EFTU MMR_HSR1 AAA_16 Arf
Other DBs
NCBI-GeneID: 109047554
NCBI-ProteinID: XP_018920787
LinkDB
Position
44
AA seq 128 aa
MATSVVPGDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHIFYNNTNNKQFII
RPAMFIKK
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcgaccagcgtggttcccggggacaacctgcccacgtataagctggtggtggtggga
gacggcggtgtggggaagagcgcgctcaccatacagttcttccagaagatcttcgtcccg
gactacgaccccaccatcgaggactcgtacctcaaacacaccgagatcgacggacagtgg
gccattctggacgttctggacacggcggggcaggaggagttcagtgcgatgagagaacag
tacatgaggacaggagacggctttctcatcgtgttttcagtcactgataaagccagcttt
gaacacgtggatcgcttccatattttttacaataatacaaacaataaacagttcataata
agaccagcaatgttcattaaaaaataa

KEGG   Cyprinus carpio (common carp): 109047565
Entry
109047565         CDS       T05134                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04144  Endocytosis
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109047565
   04012 ErbB signaling pathway
    109047565
   04370 VEGF signaling pathway
    109047565
   04371 Apelin signaling pathway
    109047565
   04068 FoxO signaling pathway
    109047565
   04150 mTOR signaling pathway
    109047565
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109047565
   04140 Autophagy - animal
    109047565
   04137 Mitophagy - animal
    109047565
  09143 Cell growth and death
   04210 Apoptosis
    109047565
   04218 Cellular senescence
    109047565
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109047565
   04540 Gap junction
    109047565
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109047565
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109047565
  09152 Endocrine system
   04910 Insulin signaling pathway
    109047565
   04912 GnRH signaling pathway
    109047565
   04916 Melanogenesis
    109047565
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109047565
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109047565
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109047565
  Exosomal proteins of colorectal cancer cells
   109047565
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109047565
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase Gtr1_RagA
Other DBs
NCBI-GeneID: 109047565
NCBI-ProteinID: XP_018920797
LinkDB
Position
44
AA seq 143 aa
MSARCPHTHPFGTEMDKWRNPCFDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRT
GEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLPARTVDTRQAQELA
RSYGIPYIETSAKTRQAGICQLP
NT seq 432 nt   +upstreamnt  +downstreamnt
atgagtgcccgttgccctcacacccaccccttcggcacagagatggacaagtggaggaat
ccttgttttgactcatataggaaacaggtggtgattgatggagagacgtgtctgttggat
atcctggatactgcaggtcaggaagagtacagtgcaatgagagaccagtacatgaggacc
ggagagggctttctctgtgtctttgccatcaacaatacaaagtcttttgaggacattcat
cagtacagggaacagattaagagggttaaagactcagatgatgtgcctatggtgcttgtg
ggtaataaatgtgacctaccagcacgcaccgtggacacaagacaagcccaggaactcgcc
cgtagctacggtataccctacattgaaacctcagccaagacaagacaggccggaatctgt
cagttaccgtaa

KEGG   Cyprinus carpio (common carp): 109048465
Entry
109048465         CDS       T05134                                 

Definition
(RefSeq) ras-related protein R-Ras-like
  KO
K07830  Ras-related protein R-Ras2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109048465
   04371 Apelin signaling pathway
    109048465
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109048465
   04137 Mitophagy - animal
    109048465
  09143 Cell growth and death
   04218 Cellular senescence
    109048465
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109048465
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109048465
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109048465
  Exosomal proteins of bladder cancer cells
   109048465
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109048465
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1
Other DBs
NCBI-GeneID: 109048465
NCBI-ProteinID: XP_018921682
LinkDB
Position
5
AA seq 196 aa
MSTEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGEETRLDILD
TAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYDEIQKFHTQILRVKDRDDFPMVLVGNK
SDLDQQRVISRDEAMSFARENRIHYMESSAKNRHNVDEAFMEVVRAIRKFQETESPPLPA
NHAGKQKSGGCPCTLL
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtcaactgaagaaagatataagttggtggtcgtgggcggtggaggtgtggggaaaagc
gccctcactattcagttcattcagtcgtactttgtgtcggactatgacccaaccattgaa
gattcatacactaaaatctgcaccgtggatggagaggagacacgattagacatcctggac
acagcaggacaagaagagttcggagcgatgagagagcagtacatgcgctccggagagggt
ttcttactggtgtttgctcttaatgacagtggcagttatgatgaaattcagaaatttcac
actcagatattgcgggtgaaggatcgagatgattttcctatggttcttgttggcaacaaa
tcagatcttgaccagcagagagtgatctcaagagatgaggcaatgtcgtttgcccgagaa
aacaggatccactatatggaatcatcagctaagaaccgccacaatgtggatgaagccttc
atggaggttgtgcgagcaataaggaagtttcaggagacagaaagtccaccgctccctgct
aatcacgcggggaagcagaagagtggtggctgtccctgcaccctcctctga

KEGG   Cyprinus carpio (common carp): 109050773
Entry
109050773         CDS       T05134                                 

Definition
(RefSeq) GTPase KRas-like
  KO
K07827  GTPase KRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109050773
   04012 ErbB signaling pathway
    109050773
   04370 VEGF signaling pathway
    109050773
   04371 Apelin signaling pathway
    109050773
   04068 FoxO signaling pathway
    109050773
   04150 mTOR signaling pathway
    109050773
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109050773
   04137 Mitophagy - animal
    109050773
  09143 Cell growth and death
   04210 Apoptosis
    109050773
   04218 Cellular senescence
    109050773
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109050773
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109050773
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109050773
  09152 Endocrine system
   04910 Insulin signaling pathway
    109050773
   04912 GnRH signaling pathway
    109050773
   04914 Progesterone-mediated oocyte maturation
    109050773
   04916 Melanogenesis
    109050773
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109050773
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109050773
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MeaB FeoB_N G-alpha ATP_bind_1 Septin NPR1_interact AAA_25
Other DBs
NCBI-GeneID: 109050773
NCBI-ProteinID: XP_018923892
LinkDB
Position
49
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRSVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK
SKSKCVLM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgaatataagcttgtggtggtaggggctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggatgaatacgacccaaccatagaggactcctac
agaaagcaggtggtgattgatggggagacgtgtctattggacatcttggacactgcaggt
caggaggagtacagcgccatgagggatcagtacatgaggacaggagagggcttcctctgt
gtcttcgccatcaataacaccaagtcctttgaggacattcaccactacagagagcagata
aagcgagtaaaggactctgaggatgtccccatggtcctggtggggaataagtgtgatctt
ccgtcccgcagtgtggacaccaagcaggctcaggatttagcacgtagctacggcatcccg
tttatagagacctcagcaaagacgagacagggcgtggacgacgcgttttatactttagtc
cgagaaatccggaagcacaaggagaagatgagcaaggagggcaagaagaaaaagaagaaa
tccaaatcaaaatgtgtattaatgtga

KEGG   Cyprinus carpio (common carp): 109058708
Entry
109058708         CDS       T05134                                 

Gene name
rras
Definition
(RefSeq) ras-related protein R-Ras
  KO
K07830  Ras-related protein R-Ras2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109058708 (rras)
   04371 Apelin signaling pathway
    109058708 (rras)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109058708 (rras)
   04137 Mitophagy - animal
    109058708 (rras)
  09143 Cell growth and death
   04218 Cellular senescence
    109058708 (rras)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109058708 (rras)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109058708 (rras)
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109058708 (rras)
  Exosomal proteins of bladder cancer cells
   109058708 (rras)
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109058708 (rras)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU ATP_bind_1 MMR_HSR1
Other DBs
NCBI-GeneID: 109058708
NCBI-ProteinID: XP_018931451
LinkDB
Position
6
AA seq 196 aa
MSNEERYKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRLDILD
TAGQEEFGAMREQYMRSGEGFLLVFALNDSGSYDEIQKFHTQILRVKDRDDFPMVLVGNK
SDLDQQRVISRDEAMSFARENRIHYMESSAKNRHNVDEAFMEVVRAIRKFQETESPPLPA
NHAGKQKSGGCPCTLL
NT seq 591 nt   +upstreamnt  +downstreamnt
atgtcaaatgaagaaagatataagttggtggtcgtgggcggtggaggtgtggggaaaagc
gccctcactattcagttcattcagtcatactttgtgtcggactatgacccaaccattgaa
gactcgtacactaaaatctgcaccgtggatggaaaggagacgcgattagacatcctggac
acagcagggcaagaagagttcggagcgatgagagagcagtacatgcgctccggagagggt
ttcttgctggtgtttgctcttaatgacagtggcagttatgatgaaattcagaaatttcac
actcagatattgcgggtgaaggatcgagatgactttcctatggttcttgttggcaacaaa
tcagatcttgaccagcagagagttatctcaagagatgaggccatgtcgtttgcccgagaa
aacaggatccactatatggaatcatcagctaagaaccgccacaatgtggatgaagccttc
atggaggttgtgcgagcaataaggaagtttcaggagacagaaagtccaccactccctgct
aatcacgcggggaagcagaagagtggtggctgtccctgcaccctgctctga

KEGG   Cyprinus carpio (common carp): 109059246
Entry
109059246         CDS       T05134                                 

Definition
(RefSeq) GTPase KRas isoform X2
  KO
K07827  GTPase KRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109059246
   04012 ErbB signaling pathway
    109059246
   04370 VEGF signaling pathway
    109059246
   04371 Apelin signaling pathway
    109059246
   04068 FoxO signaling pathway
    109059246
   04150 mTOR signaling pathway
    109059246
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109059246
   04137 Mitophagy - animal
    109059246
  09143 Cell growth and death
   04210 Apoptosis
    109059246
   04218 Cellular senescence
    109059246
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109059246
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109059246
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109059246
  09152 Endocrine system
   04910 Insulin signaling pathway
    109059246
   04912 GnRH signaling pathway
    109059246
   04914 Progesterone-mediated oocyte maturation
    109059246
   04916 Melanogenesis
    109059246
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109059246
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109059246
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 MeaB G-alpha FeoB_N ATP_bind_1 Septin NPR1_interact AAA_25
Other DBs
NCBI-GeneID: 109059246
NCBI-ProteinID: XP_018931987
UniProt: Q9YH38
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRSVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKEGKKKKKK
SKTKCVLM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgaccgaatataagcttgtggttgtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggatgaatatgacccgaccatagaggactcctac
aggaagcaggtggtgattgacggagagacatgtctattggacatcttggacactgcaggt
caggaggagtatagcgccatgagggatcagtacatgaggacaggagagggcttcctctgt
gtctttgccatcaataacaccaagtcctttgaggacattcaccactacagagagcagata
aagcgagtaaaggactcggaggacgtccccatggtcttggtggggaataagtgtgatctt
ccgtcccgcagtgtggacaccaagcaggctcaggatttagcgcgtagctacggcatccca
tttatagagacctcagcaaagacgagacagggtgtggacgacgcattttatactctagtc
cgagaaatccggaaacacaaggagaagatgagcaaggagggcaagaagaaaaagaagaaa
tccaaaacaaaatgtgtattaatgtga

KEGG   Cyprinus carpio (common carp): 109061083
Entry
109061083         CDS       T05134                                 

Definition
(RefSeq) ras-related protein R-Ras2 isoform X1
  KO
K07830  Ras-related protein R-Ras2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109061083
   04371 Apelin signaling pathway
    109061083
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109061083
   04137 Mitophagy - animal
    109061083
  09143 Cell growth and death
   04218 Cellular senescence
    109061083
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109061083
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109061083
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109061083
  Exosomal proteins of bladder cancer cells
   109061083
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109061083
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 DUF2075
Other DBs
NCBI-GeneID: 109061083
NCBI-ProteinID: XP_018933761
LinkDB
Position
Unknown
AA seq 202 aa
MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA
RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM
ILVGNKADLEQQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE
CPPSPEPTRKEKDKSGCHCVIV
NT seq 609 nt   +upstreamnt  +downstreamnt
atggctggctggaaggacggctcagtgcaggagaaatatcgcctggtggtcgtcggaggt
ggtggcgtcggaaaatcagcattaaccattcagttcatccagtcatacttcgtcactgac
tatgaccctacgattgaagactcctacacaaaacagtgtgtgattgacgagaggcctgca
cggctggacatcctggatacagcaggacaggaagagtttggagccatgagagaacaatac
atgaggacaggggagggcttccttctcgtcttctctgtcactgaccggggaagctttgaa
gagatctacaagtttcaacgacagatcttgagagtgaaggaccgggatgaatttcccatg
attctagtgggtaacaaagctgatcttgagcaacagagacaagtgacccaggaggagggc
cagcagctcgcccgacaactcaaagtcacatacatggaggcctcagctaagatccgtatg
aatgtagaccaggctttccacgagctggtccgagttataaggaagttccaggagcaagag
tgcccaccctcgccggagcccacgcgcaaagagaaggataagagcggctgccattgtgtg
attgtctaa

KEGG   Cyprinus carpio (common carp): 109062366
Entry
109062366         CDS       T05134                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04144  Endocytosis
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109062366
   04012 ErbB signaling pathway
    109062366
   04370 VEGF signaling pathway
    109062366
   04371 Apelin signaling pathway
    109062366
   04068 FoxO signaling pathway
    109062366
   04150 mTOR signaling pathway
    109062366
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109062366
   04140 Autophagy - animal
    109062366
   04137 Mitophagy - animal
    109062366
  09143 Cell growth and death
   04210 Apoptosis
    109062366
   04218 Cellular senescence
    109062366
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109062366
   04540 Gap junction
    109062366
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109062366
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109062366
  09152 Endocrine system
   04910 Insulin signaling pathway
    109062366
   04912 GnRH signaling pathway
    109062366
   04916 Melanogenesis
    109062366
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109062366
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109062366
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109062366
  Exosomal proteins of colorectal cancer cells
   109062366
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109062366
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25 CbiA
Other DBs
NCBI-GeneID: 109062366
NCBI-ProteinID: XP_018935008
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggacgaatacgaccccactatagaggactcctac
aggaagcaggtggtgattgacggggagacgtgtctgctggacatcttggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacgggagagggcttcctctgt
gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc
aagcgggtgaaggactcggatgacgtgcccatggtgctggtgggtaacaagtgtgacctc
ccggcccggacggtggacacacggcaagcacaggagctcgcgcgcagctacgggatcccc
ttcatcgagacctcagccaaaacacgacaaggtgtggaggacgcgttttacacgctggtg
cgagagatccgtcagcacaagatgaggaagctgaacccgccggacgagagcggacaggac
tgcatgagctgccgctgcgtcgtgtcgtga

KEGG   Cyprinus carpio (common carp): 109062821
Entry
109062821         CDS       T05134                                 

Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04144  Endocytosis
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109062821
   04012 ErbB signaling pathway
    109062821
   04370 VEGF signaling pathway
    109062821
   04371 Apelin signaling pathway
    109062821
   04068 FoxO signaling pathway
    109062821
   04150 mTOR signaling pathway
    109062821
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109062821
   04140 Autophagy - animal
    109062821
   04137 Mitophagy - animal
    109062821
  09143 Cell growth and death
   04210 Apoptosis
    109062821
   04218 Cellular senescence
    109062821
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109062821
   04540 Gap junction
    109062821
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109062821
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109062821
  09152 Endocrine system
   04910 Insulin signaling pathway
    109062821
   04912 GnRH signaling pathway
    109062821
   04916 Melanogenesis
    109062821
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109062821
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109062821
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109062821
  Exosomal proteins of colorectal cancer cells
   109062821
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109062821
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA Septin ATP_bind_1 AAA_25
Other DBs
NCBI-GeneID: 109062821
NCBI-ProteinID: XP_018935439
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG
CMNCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtataagttagtggtggttggtgcaggtggcgtgggcaagagtgctctgacc
atccagctcattcagaaccactttgttgatgaatacgacccaaccattgaggactcatat
agaaaacaggtggtgattgatggagagacgtgtctgttggatatcctggatactgcaggt
caggaagagtacagtgcaatgagagaccaatacatgaggactggagagggctttctctgt
gtctttgccatcaacaataccaagtcttttgaggacattcatcagtacagggaacagatt
aagagggttaaagactcagatgatgtgcccatggtgcttgtgggtaataaatgtgactta
ccagcacgcactgtggacacaagacaagcccaggaactcgcccgcagctacggtattccc
tacattgaaacctcagccaagacaagacagggagtggaagatgccttttacactcttgtc
cgtgaaatcaggcagcataaactgaggaaactgaacccgccagatgacaatggccaaggc
tgtatgaactgccgctgtgtggtgtcatga

KEGG   Cyprinus carpio (common carp): 109066952
Entry
109066952         CDS       T05134                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109066952
   04371 Apelin signaling pathway
    109066952
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109066952
   04137 Mitophagy - animal
    109066952
  09143 Cell growth and death
   04218 Cellular senescence
    109066952
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109066952
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109066952
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109066952
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase ATP_bind_1 Septin MMR_HSR1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn
Other DBs
NCBI-GeneID: 109066952
NCBI-ProteinID: XP_018939512
LinkDB
Position
Unknown
AA seq 208 aa
MATSVVPGDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLVHLRKISSEQGREMASKHSITYIETSAKDPPMNVDKAFHELVRVIRQQIP
ERGLKKKRKAKWRADRPSGSQRLHCVLL
NT seq 627 nt   +upstreamnt  +downstreamnt
atggcgacgagcgtggttcccggggacaacctgcctacatataagctggtggtggtggga
gacggaggcgtggggaagagcgcgctcaccatacagttcttccagaagatcttcgtcccg
gactacgaccccaccatcgaggactcgtacctcaaacacaccgagatcgacggccagtgg
gccattctggacgttctggacacggcggggcaggaggagttcagtgcgatgagagagcag
tacatgaggacaggagacggctttctcatcgtgttttcagtcactgataaagccagtttt
gaacatgtggatcgtttccaccagctgattctgagagtgaaggacagggagtcgtttccc
atggttctggtggctaataaagttgacctggtgcatttacgcaagatcagtagtgagcag
ggccgcgagatggcctccaaacacagcatcacgtatattgaaacaagtgcaaaggatcca
cccatgaatgtagacaaagcgtttcacgagctcgtcagagtgatacgccagcagatccca
gaacggggcctgaagaagaagaggaaagccaaatggcgggcagacaggccttcgggttcc
cagaggctgcactgcgtcttactgtga

KEGG   Cyprinus carpio (common carp): 109069553
Entry
109069553         CDS       T05134                                 

Definition
(RefSeq) GTPase HRas-like isoform X1
  KO
K07827  GTPase KRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109069553
   04012 ErbB signaling pathway
    109069553
   04370 VEGF signaling pathway
    109069553
   04371 Apelin signaling pathway
    109069553
   04068 FoxO signaling pathway
    109069553
   04150 mTOR signaling pathway
    109069553
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109069553
   04137 Mitophagy - animal
    109069553
  09143 Cell growth and death
   04210 Apoptosis
    109069553
   04218 Cellular senescence
    109069553
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109069553
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109069553
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109069553
  09152 Endocrine system
   04910 Insulin signaling pathway
    109069553
   04912 GnRH signaling pathway
    109069553
   04914 Progesterone-mediated oocyte maturation
    109069553
   04916 Melanogenesis
    109069553
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109069553
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109069553
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU FeoB_N MMR_HSR1 G-alpha ATP_bind_1 AAA_14 Septin AAA_25
Other DBs
NCBI-GeneID: 109069553
NCBI-ProteinID: XP_018941732
LinkDB
Position
Unknown
AA seq 187 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHLYREQINRVKDSDNVPMVLVGNKSDL
ASRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKHT
QRRCTLL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccgaatacaagctggtagttgtgggggctggtggcgttgggaaaagcgctctgacc
atccagctcattcagaatcactttgtggacgagtatgaccccactattgaggattcttac
agaaagcaggttgtgattgacggagagacgtgtttgctggacatcctggacaccgcaggt
caggaggagtacagtgccatgagagatcagtatatgaggacaggagagggctttctgtgt
gtgtttgccatcaacaacgccaagtcctttgaggacgtgcatctttacagggagcaaata
aaccgtgtcaaagacagcgacaacgtcccgatggtgctggtggggaacaagagtgacctg
gcctctcgtactgtagagacgcgtcaagcccaagaactcgccagaagttatggggtccca
tttgtcgaaacatctgccaaaacgcgacagggagttgaggaggcattttactctctcgtg
cgggaaatccgaagatacaaggagacgaaccgcagcaataagaagagcaaaaagcacaca
cagagacgctgcactcttttatag

KEGG   Cyprinus carpio (common carp): 109070813
Entry
109070813         CDS       T05134                                 

Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04144  Endocytosis
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109070813
   04012 ErbB signaling pathway
    109070813
   04370 VEGF signaling pathway
    109070813
   04371 Apelin signaling pathway
    109070813
   04068 FoxO signaling pathway
    109070813
   04150 mTOR signaling pathway
    109070813
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109070813
   04140 Autophagy - animal
    109070813
   04137 Mitophagy - animal
    109070813
  09143 Cell growth and death
   04210 Apoptosis
    109070813
   04218 Cellular senescence
    109070813
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109070813
   04540 Gap junction
    109070813
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109070813
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109070813
  09152 Endocrine system
   04910 Insulin signaling pathway
    109070813
   04912 GnRH signaling pathway
    109070813
   04916 Melanogenesis
    109070813
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109070813
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109070813
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109070813
  Exosomal proteins of colorectal cancer cells
   109070813
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109070813
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA Septin FeoB_N ATP_bind_1 ParA Ldh_1_N AAA_25 AAA_16 PglD_N CbiA
Other DBs
NCBI-GeneID: 109070813
NCBI-ProteinID: XP_018942865
LinkDB
Position
Unknown
AA seq 152 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PTRMVDTRQAQELARSYGIPFIETSAKTRQQN
NT seq 459 nt   +upstreamnt  +downstreamnt
atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc
atccaactcatccagaaccactttgtggacgaatacgaccccactatagaggactcctac
aggaagcaggtggtgattgacggggagacgtgtctcctggacatcttggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt
gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc
aagcgggtgaaggactcggatgacgtgcccatggtgctggtgggtaacaagtgtgacctc
ccgacccggatggtggacacacggcaagcgcaggagctcgcgcgcagctacgggatcccc
ttcatcgagacctcagccaaaacacgacagcaaaactag

KEGG   Cyprinus carpio (common carp): 109084682
Entry
109084682         CDS       T05134                                 

Definition
(RefSeq) GTPase NRas-like
  KO
K07828  GTPase NRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109084682
   04012 ErbB signaling pathway
    109084682
   04370 VEGF signaling pathway
    109084682
   04371 Apelin signaling pathway
    109084682
   04068 FoxO signaling pathway
    109084682
   04150 mTOR signaling pathway
    109084682
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109084682
   04137 Mitophagy - animal
    109084682
  09143 Cell growth and death
   04210 Apoptosis
    109084682
   04218 Cellular senescence
    109084682
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109084682
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109084682
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109084682
  09152 Endocrine system
   04910 Insulin signaling pathway
    109084682
   04912 GnRH signaling pathway
    109084682
   04916 Melanogenesis
    109084682
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109084682
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109084682
  Exosomal proteins of other body fluids (saliva and urine)
   109084682
  Exosomal proteins of breast cancer cells
   109084682
  Exosomal proteins of colorectal cancer cells
   109084682
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109084682
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin VirE Ldh_1_N
Other DBs
NCBI-GeneID: 109084682
NCBI-ProteinID: XP_018954892
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNLKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL
ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC
LGVSCEVM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgacggagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaacc
atccagctcattcaaaatcactttgtggatgaatatgaccctactattgaggactcttac
aggaagcaggtggtgattgacggtgagacgtgtctgttggacatcctggacactgcaggt
caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt
gtctttgccataaacaacctcaaatccttcgccgatgtgcatttgtacagagaacagatc
aagcgcgtgaaggactcggatgatgttcccatggtcctagtggggaacaagtgcgatttg
gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt
gtagaaacttcagccaagaccagacagggagttgaggatgctttttacaccctcgtccgt
gagatccgacattatcgcatgaaaaagctcaacagcagagaagacaggaagcagggctgt
ctgggcgtgtcctgtgaagtcatgtga

KEGG   Cyprinus carpio (common carp): 109084683
Entry
109084683         CDS       T05134                                 

Definition
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04540  Gap junction
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109084683
   04012 ErbB signaling pathway
    109084683
   04370 VEGF signaling pathway
    109084683
   04371 Apelin signaling pathway
    109084683
   04068 FoxO signaling pathway
    109084683
   04150 mTOR signaling pathway
    109084683
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109084683
   04137 Mitophagy - animal
    109084683
  09143 Cell growth and death
   04210 Apoptosis
    109084683
   04218 Cellular senescence
    109084683
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109084683
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109084683
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109084683
  09152 Endocrine system
   04910 Insulin signaling pathway
    109084683
   04912 GnRH signaling pathway
    109084683
   04916 Melanogenesis
    109084683
Membrane trafficking [BR:ccar04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    109084683
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109084683
  Exosomal proteins of other body fluids (saliva and urine)
   109084683
  Exosomal proteins of breast cancer cells
   109084683
  Exosomal proteins of colorectal cancer cells
   109084683
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109084683
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin VirE Ldh_1_N
Other DBs
NCBI-GeneID: 109084683
NCBI-ProteinID: XP_018954893
LinkDB
Position
Unknown
AA seq 188 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL
ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLNSREDRKQGC
LGVSCEVM
NT seq 567 nt   +upstreamnt  +downstreamnt
atgactgagtataagttggtggttgtgggagcaggtggtgttgggaagagtgctttaacc
atccagctcattcagaatcactttgtggatgaatatgaccctactattgaggactcttac
aggaagcaggtggtcattgacggtgagacgtgtctgctggatatcctggacactgcaggt
caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt
gtctttgccataaataacagcaaatcctttgcagatgtgcatttgtacagagaacagatc
aagcgcgtgaaggactccgatgatgttcccatggtcctagtggggaacaagtgtgatttg
gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcatagagttt
gtagaaacttctgccaagaccagacagggagttgaggatgctttttacacccttgtccgt
gagatccggcattatcgcatgaaaaagctcaacagcagagaagacagaaagcagggctgt
ctgggcgtgtcctgtgaagtcatgtga

KEGG   Cyprinus carpio (common carp): 109084783
Entry
109084783         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ras-related protein R-Ras2-like
  KO
K07830  Ras-related protein R-Ras2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109084783
   04371 Apelin signaling pathway
    109084783
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109084783
   04137 Mitophagy - animal
    109084783
  09143 Cell growth and death
   04218 Cellular senescence
    109084783
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109084783
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109084783
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   109084783
  Exosomal proteins of bladder cancer cells
   109084783
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109084783
SSDB
Motif
Pfam: Ras Arf Roc DUF2075 GTP_EFTU RsgA_GTPase NPHI_C
Other DBs
NCBI-GeneID: 109084783
NCBI-ProteinID: XP_018954988
LinkDB
Position
Unknown
AA seq 127 aa
MREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILVGNKADLEQQRQV
TQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKS
GCHCVIV
NT seq 384 nt   +upstreamnt  +downstreamnt
atgagagaacaatacatgaggacaggggagggcttccttctcgtcttctctgtcactgac
cggggaagctttgaagagatctacaagttccaacgacagatcttgagagtgaaggaccgg
gatgaatttcccatgattctagtgggtaacaaagctgatcttgagcaacagagacaagtg
acccaggaagaggggcagcagctcgcccgacaactcaaagtcacatacatggaggcctca
gctaagatccgtatgaatgtagaccaggctttccacgagctggtccgagtcataaggaag
ttccaggagcaagagtgcccaccctcgccggagcccacgcgcaaagagaaggataagagc
ggctgccattgtgtgattgtctaa

KEGG   Cyprinus carpio (common carp): 109087650
Entry
109087650         CDS       T05134                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109087650
   04371 Apelin signaling pathway
    109087650
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109087650
   04137 Mitophagy - animal
    109087650
  09143 Cell growth and death
   04218 Cellular senescence
    109087650
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109087650
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109087650
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109087650
SSDB
Motif
Pfam: Ras Roc Septin GTP_EFTU MMR_HSR1 AAA_16 Arf
Other DBs
NCBI-GeneID: 109087650
NCBI-ProteinID: XP_018957404
LinkDB
Position
Unknown
AA seq 181 aa
MATSVVPGDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHIFYNNTNNKQFII
RPITYIETSAKDPPMNVDKAFHELVRVIRQQIPERGLKKKRKAKWRADRPSGSQRLHCVL
L
NT seq 546 nt   +upstreamnt  +downstreamnt
atggcgaccagcgtggttcccggggacaacctgcccacgtataagctggtggtggtggga
gacggcggtgtggggaagagcgcgctcaccatacagttcttccagaagatcttcgtcccg
gactacgaccccaccatcgaggactcgtacctcaaacacaccgagatcgacggacagtgg
gccattctggacgttctggacacggcggggcaggaggagttcagtgcgatgagagaacag
tacatgaggacaggagacggctttctcatcgtgttttcagtcactgataaagccagcttt
gaacacgtggatcgcttccatattttttacaataatacaaacaataaacagttcataata
agaccaatcacgtatattgaaacaagtgcaaaggatccgcccatgaatgtagacaaagcg
tttcacgagctcgtcagagtgatacgtcagcagatcccagaacggggcctgaagaagaag
aggaaagccaaatggcgggcggacagaccttcgggttcgcagaggctgcactgcgtctta
ctgtga

KEGG   Cyprinus carpio (common carp): 109096009
Entry
109096009         CDS       T05134                                 

Definition
(RefSeq) ras-related protein M-Ras-like
  KO
K07831  Ras-related protein M-Ras
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109096009
   04371 Apelin signaling pathway
    109096009
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109096009
   04137 Mitophagy - animal
    109096009
  09143 Cell growth and death
   04218 Cellular senescence
    109096009
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109096009
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109096009
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109096009
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Septin Gtr1_RagA AAA_16
Other DBs
NCBI-GeneID: 109096009
NCBI-ProteinID: XP_018965224
LinkDB
Position
17
AA seq 209 aa
MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW
AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP
MVLVANKVDLVHLRKVTNEQGCEMAAKHNITYIETSAKDPPMNVDRAFHELVRVIRQQVP
EWSLKKKKKTKWRGDRAMSSSHKRHCVIL
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcaaccagtgcggtccctagcgacaaccttccaacatacaaattggtggttgtggga
gatggaggcgtgggaaagagtgctcttaccatccagtttttccaaaagatttttgtgcca
gattatgatcctactattgaagactcctacttgaaacacacagagatcgatggccagtgg
gctattttggatgttttagacacagcaggtcaagaggaattcagcgccatgcgagagcag
tacatgaggactggtgatggtttcctcattgtgttctctgtgacggacaaggccagtttt
gaacacgtcgatcggtttcaccagctcatcctacgagtgaaagatagggaatctttcccc
atggttttggtggctaacaaagtggacctagtgcatctgaggaaagtgacaaatgaacag
ggctgtgagatggccgccaaacacaatattacttacattgaaacaagtgccaaggatcct
ccaatgaatgtggacagagcctttcatgaactagtccgagttatcagacagcaagttcca
gagtggagtctgaaaaagaagaaaaagacaaagtggcgtggagacagagccatgagttct
tctcacaagcgtcactgtgtgatattgtga

KEGG   Cyprinus carpio (common carp): 109096718
Entry
109096718         CDS       T05134                                 

Definition
(RefSeq) ras-related protein M-Ras isoform X1
  KO
K07831  Ras-related protein M-Ras
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04137  Mitophagy - animal
ccar04140  Autophagy - animal
ccar04218  Cellular senescence
ccar04371  Apelin signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109096718
   04371 Apelin signaling pathway
    109096718
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109096718
   04137 Mitophagy - animal
    109096718
  09143 Cell growth and death
   04218 Cellular senescence
    109096718
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109096718
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109096718
GTP-binding proteins [BR:ccar04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    109096718
SSDB
Motif
Pfam: Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16
Other DBs
NCBI-GeneID: 109096718
NCBI-ProteinID: XP_018965896
LinkDB
Position
18
AA seq 243 aa
MKRFRVRLNRKRPEAMKCSYITDLFRASSAGVAVIMATSAVPSDNLPTYKLVVVGDGGVG
KSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQWAILDVLDTAGQEEFSAMREQYMRTG
DGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFPMVLVANKVDLVHLRKVTNEQGCEMA
AKHNITYIETSAKDPPMNVDRAFHELVRVIREQVPERSLKKKKKTKWRGDRAMSSHKLHC
VIL
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaacgattccgagtccgactgaaccgaaagcggccagaagcaatgaaatgcagctac
atcactgacctgttcagggcttcaagtgcaggtgtagctgttatcatggcaaccagtgcg
gtccctagcgacaacctcccaacgtataaattggtggttgtgggagatggaggagtggga
aagagtgctcttaccatccagtttttccaaaagatttttgtgccagattacgatcctact
attgaagactcctacttgaaacacacagagatcgatggccagtgggctattttggatgtt
ttagacacagcaggtcaagaggaattcagtgccatgcgagagcagtacatgaggactggt
gatggtttcctcattgtgttctctgtgacggacaaggccagttttgaacatgtcgaccgc
tttcaccagctcatcctacgagtcaaagaccgggaatctttccctatggttttggtggct
aacaaagtggacctggtgcatctgaggaaagtgacaaatgaacagggctgtgagatggca
gccaaacacaacattacttacattgaaacaagtgccaaggatcctccaatgaatgtggac
agagcctttcatgaattagtcagagttatcagagagcaagttccagagcggagtctgaaa
aagaagaaaaagacaaagtggcgcggagacagagccatgagttctcacaagcttcactgt
gtgatattgtga

DBGET integrated database retrieval system