KEGG   Cyprinus carpio (common carp): 109048953
Entry
109048953         CDS       T05134                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
ccar04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109048953
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109048953
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ccar04030]
    109048953
G protein-coupled receptors [BR:ccar04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    109048953
SSDB
Motif
Pfam: 7tm_1 DUF4752 TMEM192
Other DBs
NCBI-GeneID: 109048953
NCBI-ProteinID: XP_018922156
LinkDB
Position
5
AA seq 358 aa
MLFNSTCEAFYKPVSFFYNITGKPISPNWRTHDFIVVGLGLPICVFIILANMLVIVAIII
NRKFHFPIYYLLGNMAAADLFAGISYLYLVFHTGPWTIGLTIKEWFIRGALINMSLTASV
VNLLAVAVERHQTIFTMQLHSTMTRRRVVMLIVTIWLVAVVMGLVPTMGWNCVCDLSTCC
TVAPLYSRSFLVSWAILNLMAFFIMVAVYTHIFIYVRRRSRVMSPHTDQPSNNQTVISLM
KTMSMILGAFVICWTPGLVILLLDGLSCSQCQVLKYEKYCLVLAECNSLVNPIIYSFRDE
DMRNTYKRILCFPWRRMRQHEGPSGIRFKPVKAGAPSEKNSCNSTSLEPSSPQSLLFS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgttatttaattctacctgtgaggctttttacaagccagtgtccttcttctacaacatt
actggcaagcccatcagcccgaactggcgcactcatgactttattgtggttggcctcggg
ctcccgatttgtgtctttattattctagcaaatatgttggtcatagtggccataatcatc
aaccgaaagttccactttcccatttattacttacttgggaacatggcggccgcggacctc
tttgctggaatatcgtatctctaccttgtgttccacacggggccgtggacaatcggtttg
accatcaaagagtggtttattcgtggagctttgatcaacatgagcttgaccgcgtctgtg
gtcaacctgctggcagtggcagtggagcgccatcagaccatcttcaccatgcagctccac
agcaccatgaccaggaggcgcgtggtgatgctgatagtcaccatctggttggtggccgtc
gtcatgggtttggtgcccaccatgggctggaactgtgtttgtgacctgtccacctgctgc
acggttgcgccgctgtattcccgcagcttcctagtgtcctgggccatcctcaacctcatg
gccttcttcatcatggtggccgtttacactcacatcttcatctacgttcgccggcggagc
cgagtaatgtcgccacacacggatcagccctccaacaatcagactgttatcagcctcatg
aagaccatgtccatgattctgggtgcctttgtgatctgttggacaccgggtctggtgatt
ctgttactggacggtctcagctgcagtcaatgtcaggttcttaaatatgaaaagtactgc
ctggttctggccgagtgtaactctctggtgaaccccatcatctactcgttccgggacgag
gacatgaggaacacctacaaacgcattctctgcttcccttggagaagaatgcggcagcat
gaggggccttctggcatccgcttcaagcctgtgaaagcaggggcaccctcggagaaaaac
agctgtaactccaccagtttagagcccagttcaccacaaagcctattgttttcatag

DBGET integrated database retrieval system