KEGG   Cyprinus carpio (common carp): 109049362Help
Entry
109049362         CDS       T05134                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109049362
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109049362
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    109049362
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin TPR_7 TPR_17 TPR_20
Motif
Other DBs
NCBI-GeneID: 109049362
NCBI-ProteinID: XP_018922616
LinkDB All DBs
Position
47
AA seq 649 aa AA seqDB search
MAEVEEQGRNLSEESTDESEEEDTEEEPKLKYERLTNGVTEILQKDAASCMTVHDKFLAL
GTHFGKVYLLDIQGNVTQKFEISPVKINQISLDESGDHVGICSEDGKVQVFGLYTREGFH
ENFDCPIKVVALHPQFSKSNNKQFVTGGNKLLLYERNWLNRWKTSVLHEGEGNITNVKWR
ANLIAWANNVGVKIYDISSKQRITNVLRDNTNLRPDMYPCSLCWKDNTTLIIGWGSSVKV
CVQYNCRSSVLITRELSVSAFETEFFISGLAPLADQLVTLYYVKDSSEHMEEEFRTRPRL
DIIQSLPEGCEEISSDALTVRNFQENQCRDYRLEHSEGESLFYIISPKDIVVAKERDQDD
HIDWLLEKKKYEEALMAAEISFRNIKRHDVQKIGMAYINHLVERGDYDAAARKCQKVLGK
NMDLWENEVYRFKTIGQLKAISQYLPRGDLRLRPAIYEMILHEFLKTDYEGFATLIREWP
GELYNNMAIVQAVNEHLKKDPTNSMLLTTLAELYTYDQRYDRALEIYLKLRHKDVYQLIH
KHNLFSAIKDKIVLLMDFDKEKAVDMLLDNDDKISMDKVVEELKDRPELLHVYLHKLFKR
DHHKGQKYHERQISLYAEYDRPNLLPFLRESMHCPLEKVSITFVSLNGK
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtggaggagcagggaagaaacttaagtgaagaatccacagatgagtcagag
gaggaggacacagaagaggagcctaaactgaagtacgaaaggctgaccaatggcgtgaca
gagatcttgcagaaggatgcggccagctgcatgacagtgcatgacaagttcctggctctt
gggacacactttggaaaggtttaccttttggatattcaaggaaatgttacacagaagttt
gaaattagtccagtgaaaataaaccagatcagtttggatgagagtggcgatcatgttggc
atctgctctgaagatggaaaggtgcaagtgttcggcctgtacactagggagggcttccat
gaaaactttgactgtcccatcaaggtcgtagcgctacaccctcagttcagcaaatccaac
aataaacagtttgtgactggaggaaataagcttttgctttatgagagaaactggctgaac
cggtggaagacctctgttctacatgaaggagagggaaacatcaccaatgtgaaatggaga
gccaatctcattgcctgggcaaacaatgtgggtgtgaaaatttatgacatcagcagtaaa
cagcgcatcactaacgtgttgcgggacaacaccaatcttaggccggatatgtacccctgc
agtctgtgctggaaagacaacaccacgctgatcatcggctggggctcttctgttaaggtg
tgtgttcagtacaactgcagatcaagtgttttaataactagggaactttcagtgtcagca
ttcgagaccgagttcttcattagtggactggcgcctttggcagatcagctagtcactctg
tactatgtcaaggacagctctgagcacatggaggaggagttcagaacacggcctcgttta
gacatcatccagtcgttacccgagggctgtgaggagatctcatcagacgctctcactgta
cgcaacttccaggagaaccagtgcagggactaccggctcgaacactctgagggagagtct
ctattctacatcatcagccctaaagacattgtagtggctaaagaaagagaccaggatgac
cacatcgactggcttctggagaagaagaaatatgaagaagcactgatggctgcagagatc
agcttcagaaacattaaacggcatgatgtacagaaaattggaatggcgtacatcaatcat
ctggtggagagaggagattatgatgcagctgccagaaagtgtcaaaaagtgctaggaaag
aacatggatctctgggagaatgaagtgtacaggtttaaaaccattggacagttgaaagcc
atcagtcaatacttaccaagaggagaccttcgtcttcgaccagcaatttatgagatgata
cttcatgagttcctcaagactgactatgagggctttgccacactgattcgtgagtggccg
ggagagctgtataacaacatggctatagttcaggcagtgaatgaacacctgaagaaggac
cccaccaacagcatgcttctcaccacactggccgaactctacacatatgatcagcgttat
gatcgtgctctggagatctacctgaaactgagacacaaagatgtttaccaactcattcac
aaacacaacctattctccgccatcaaagacaagattgtcctactcatggatttcgacaaa
gagaaagctgttgacatgctgctggataatgatgataaaatatcgatggacaaagtggtg
gaggaattaaaagacagacctgagctgttacatgtgtatttgcataagctgtttaagcgg
gaccatcataaggggcagaagtaccatgagaggcagatcagtttgtatgccgagtatgac
cgacccaacctactgcccttcctcagagagagcatgcactgcccactagagaaggtttct
ataacatttgtgtcactaaacgggaaataa

DBGET integrated database retrieval system