KEGG   Cyprinus carpio (common carp): 109050800Help
Entry
109050800         CDS       T05134                                 

Definition
(RefSeq) transcription factor PU.1-like
  KO
K09438  transcription factor PU.1
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109050800
Transcription factors [BR:ccar03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    109050800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 109050800
NCBI-ProteinID: XP_018923916
LinkDB All DBs
Position
49
AA seq 255 aa AA seqDB search
MLHYRMESCVISPLSEELIPYDPDARPIYDFYPYLSTDPQTHPESGWDYTSVHGHHGEFE
PPQGNHFTELHPSTYRYGDVESFHPSVDSGMGTLLPVVPPQYTYVPHTLYQRSPVPHCST
DDEDPGGRSPPFEVSEGEEDNDRHPGISSSGNKRKVRLYQFLLDLLQDGDMRDCIWWVDR
ERGIFQFSSKHKETLAGRWGQQKGNRKRMTYQKMARALRNYGKTGEVKKVKKKLTYQFSS
EVMRRMPTDRRQYHH
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgttgcattacagaatggaaagctgtgttatttcacctttgtcagaagaattaattccg
tatgatccagatgctcggccgatatatgacttctacccgtatctcagtactgaccctcag
actcatcctgaaagtggatgggactacacaagtgttcatggccatcacggtgaatttgag
ccgcctcaaggaaaccatttcactgagctgcatcccagcacataccgctacggagacgtg
gagtccttccatccatctgtagattcagggatgggaacacttttacctgtcgttcctcca
cagtatacttacgtcccccacacactgtaccagcggtcccccgtcccccactgcagtact
gatgatgaggaccccgggggacgcagcccaccctttgaggtgtccgagggtgaggaggac
aacgacagacatccaggcatctccagctcaggaaacaagcggaaagtgcgtctctatcag
ttcctcctggacctcctgcaggacggagacatgcgggactgcatctggtgggtggaccga
gagcgaggcatctttcagttctcctccaaacacaaggagactctcgccggccgctggggc
cagcagaagggcaaccgcaagagaatgacctaccagaagatggccagggccctgcgcaac
tacggcaagaccggcgaggtcaaaaaggtcaagaagaagctcacgtaccagttcagcagc
gaggtgatgaggaggatgcctacggacaggagacagtatcatcactga

DBGET integrated database retrieval system