KEGG   Cyprinus carpio (common carp): 109051735
Entry
109051735         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 1-like
  KO
K03099  son of sevenless
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04150  mTOR signaling pathway
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109051735
   04012 ErbB signaling pathway
    109051735
   04068 FoxO signaling pathway
    109051735
   04150 mTOR signaling pathway
    109051735
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109051735
   04540 Gap junction
    109051735
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109051735
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109051735
   04912 GnRH signaling pathway
    109051735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109051735
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   109051735
SSDB
Motif
Pfam: RasGEF RasGEF_N Histone RhoGEF PH Herpes_UL92
Other DBs
NCBI-GeneID: 109051735
NCBI-ProteinID: XP_018924767
LinkDB
Position
Unknown
AA seq 1045 aa
MIIRNVPQERVQRSFPHPIEKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGYKID
HQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMFHQVEEDI
SVFPLDEEPSAAEEQMYYDLVKAFMAEVRQYLRDLNLIIKVFREPFASNTMLFSAHDVEN
IFSRIVDIHEVTVKLLGLIEDTVEMTDEGSPHPIAIGVGHFQELAFDPYETYAQDILRSG
FHDHFLSQLSKPGAALYLQSICEGFKEAVQYVLPRLLLTPVYHCLHYFEILKASVIQHFS
NPAQAIVSKISLKQVKFRISSINAAAVLRDFESACRFYSQQMKGKHLAIKKMNEIQRNID
GWEGKDIGQCCNEFIMEGTLTRVGDGQPRLPGASAAEYRLKEKFFMRKVQINDKDDKEGE
YRHAFEIILKDGNSVVFAAKSAEEKNGWMAALISLQYRSTLERMLDTAMLQEEKEEQMRL
PGAEVYRFAQPDSEENVVFEENVQSKSGIPIIKAGTVLKLIERLTFHMYADPNFVRTFLT
TYRSFCKSQELLDLLMERFDIPEPKPTEADQMAMENGDQPLSAELKRFRKEFVQPVQLRV
LNVCRHWVEHHFYDFERDAQLLRQLEEFIGMVRGKAMRKWVESITKIIQRKKQAQANGPS
HNITFESSPPPIEWHLCKAGQTDQFDLMTLHPIEIARQLTLLESDFYRAVQPSELVGSVW
TKEDKEINSPNLLRMIRHTTNLTLWFEKCIVEAENVEERVAVISRIIEILQVFQELNNFN
GVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEEAHELSEDHYKKYLAKLRSINPPCVPF
FGIYLTNILKTEEGNPDFLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVENDIQK
FFENLNPMEDMTEKEFADYLFNKSLEIEPRNARTLPRFPKKYSCPLKSPGVRPSTVRQGT
MRHPTPLQNEPRKISYSRIPDSETESSAASAPNSPRTPLTPPPASTASSSTEICSVFDSP
QPPSSPFHSNSDTIFAPVSLPHGPR
NT seq 3138 nt   +upstreamnt  +downstreamnt
atgataatcagaaatgtcccccaggagcgtgttcagaggagtttcccgcaccccatcgag
aaatgggccatcgccgacgctcaggccgctatcgagaagaggaagaggaggaacccgctg
gcacttcctgtcgacaagatccacccgctgctcaaggaggttctgggttataagatcgat
catcaggtgtcggtgtacatcgtggcggtgctggagtacatctctgcagatatcctgaag
ctggccgggaactacgtgcggaacattcgtcactatgagatctcgcagcaggacatcact
gtggccatgtgtgccgataaggtgctgatggacatgttccatcaggtggaggaggacatc
agtgtgtttcctctggacgaggagccgtcggcggccgaggagcagatgtactatgatctg
gtgaaggccttcatggcggaggtgcgtcagtatctgcgcgacctcaacctcatcatcaag
gttttccgtgagcccttcgcctccaacaccatgctgttctccgctcacgacgtggagaac
atcttcagccggatcgtggacatccacgaggtgacggtgaagctgctggggctgatcgag
gacacggtggagatgacggacgagggcagtcctcaccctatagccatcggcgtgggccat
tttcaggagctggcctttgacccctacgagacgtacgcacaggatatcctgcgcagcggc
ttccacgaccacttcctgagtcagctgtccaaacccggagcggccctctacctgcagtcc
atctgtgagggcttcaaagaggcggtgcagtatgtgttaccacggttactcctcacgccc
gtctaccactgtctgcattacttcgagattctaaaggcgagtgtcattcaacacttttct
aaccctgctcaagctattgtttccaagatctcgctaaaacaagtgaagtttcgcatctct
tcgatcaatgcagcggctgttcttcgggatttcgagtcggcgtgccgcttctacagccag
cagatgaagggcaaacacctggccatcaagaagatgaatgagatccagaggaacatcgac
ggctgggaggggaaagacatcggccagtgctgcaacgagttcatcatggagggcacgctc
acgcgggtcggagacggccagccgcgtctgccgggagccagcgccgccgagtaccggctc
aaagagaagttcttcatgaggaaggtccagatcaacgacaaggacgataaggagggcgag
taccggcacgccttcgagatcatcctgaaggacgggaacagcgtggtgttcgctgctaaa
tctgcggaggagaagaacggctggatggcggcgctgatctcgctgcagtaccgctccacg
ctggagcgcatgctggacacggccatgctgcaggaggagaaggaggagcagatgaggctc
cccggggccgaggtgtaccgcttcgctcagcccgactccgaggagaacgtcgtgttcgag
gagaacgtccagtccaaatccggcattcccatcatcaaagccggaacggtgctgaagctc
atcgagcggctgaccttccacatgtacgccgatcctaatttcgtcaggacgtttctgacc
acgtaccgatcgttctgtaaatctcaggagctgctggatctgctcatggagaggtttgat
attcctgaacccaaacccacggaagcggatcagatggccatggagaacggagaccagccg
ctgagcgcagaactcaaacgcttccgcaaagagttcgttcagcctgtacagctgagggtg
ttgaatgtgtgcaggcactgggtcgagcatcatttctatgactttgagagagacgctcag
ttgctgcggcagctggaggagtttatcggcatggtcagaggtaaggccatgaggaagtgg
gtggagtccatcacgaagatcatccagaggaagaaacaggctcaagccaacggccccagt
cacaacatcacgttcgagagctcgccgccgcccatcgagtggcacctgtgtaaagcggga
cagacggatcagtttgacctcatgacccttcaccccatcgagatcgcccgacagctcaca
ctgctggagtccgacttctacagggcggttcagccgtcagagctggtgggcagcgtttgg
actaaagaagacaaggagatcaactccccgaacctgctgcggatgatccgccacaccacc
aacctcacgctgtggttcgagaagtgcatcgtagaagcggagaacgtggaggagcgtgtg
gccgtcatatcgcgcattatcgagatcctgcaggtctttcaggagctcaataacttcaat
ggcgttctggaggtggtgagcgccatgaactcgtcgcccgtctacagactcgaccacacc
ttcgagcaaatcccgagcagacagaggaagattctggaggaagctcatgaactcagtgaa
gatcattataagaaatatctggctaaactcaggtccatcaaccccccctgtgtgcccttc
tttgggatttatttaacaaatattctgaaaactgaggagggaaatccagacttcctgaag
agacatggcaaggaactgatcaacttcagcaaacggcggaaagtggcggaaataaccgga
gaaatccagcagtaccagaaccagccgtactgcttacgtgtggaaaacgacatacagaag
ttctttgagaacctgaacccgatggaggacatgacggagaaggagttcgccgactatctg
ttcaacaaatctctggagatcgagccgcgtaacgctcgcacgctgcctcgattcccgaag
aagtacagctgtcctctgaagtctccgggtgttcgcccgtccaccgtccggcagggaacc
atgcggcacccgacgccgctgcagaacgagccccgaaagatcagctacagccgcatccca
gacagcgagacggagagcagcgccgcttcagcacccaactctccccgcactccactgacg
cctccaccagcctccaccgcatccagctccaccgagatctgcagcgtcttcgactcgcca
cagccgccctccagccccttccactccaacagcgacactatattcgctccggtctctctc
ccgcacggcccacgttag

KEGG   Cyprinus carpio (common carp): 109078065
Entry
109078065         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2-like
  KO
K03099  son of sevenless
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04150  mTOR signaling pathway
ccar04510  Focal adhesion
ccar04540  Gap junction
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109078065
   04012 ErbB signaling pathway
    109078065
   04068 FoxO signaling pathway
    109078065
   04150 mTOR signaling pathway
    109078065
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109078065
   04540 Gap junction
    109078065
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109078065
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109078065
   04912 GnRH signaling pathway
    109078065
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109078065
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   109078065
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH
Other DBs
NCBI-GeneID: 109078065
NCBI-ProteinID: XP_018948918
LinkDB
Position
Unknown
AA seq 1343 aa
MQHDFSSNEESSARWRGLFVQALRKVQLQVHPNLSAKEDALQHIEALILQLLNKLCVTQP
RTIADVEDRVQKTFPNPIDKWAMSDAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYKIDY
HVCLYIVAVLEYIAADILKLAGNYVSNIRHYEISQQDITVSMCADKVLMDMFDQEEEMGL
VSQSIEEVSSSGVLTYDDLVRLEIAEERQYLRELDLIIKVFRQALTSNSKLFSTQDVELA
FSNILEVHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILSK
EYCQHFNTLMSRPTVALYFQSIAEGFKEAVQYVLPQLMMVPVYHCMHYFELLQQLQECSE
DQDDRECLKQAQTALINLQCSIERIYAKHQPRRKQGEPLYRLYNRASRSKQAAIKRMNDI
QRCIDGWEGRDIGQCCSQFIMEGALLRTGAKHERHNFLFDGLMISCKANQSSRLPGAGSG
AEWGRVRLKEKFVLRKYRIVDREDSPDFCHAFELVGREESGAVFSARSAEEKSAWMAALV
TLQYRPTLDRMLDTVLHREEQAQPLRLPSPDIYRFAIQDSEENIVFEEGAQRKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQDLLTLLIERIEIPEPEPSEADREA
LWNGEQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELSCGLEEYLTSTT
QLRGKSMRKWVESIIKIMRRXKQTQSNGISHNITFESPPPPIEWHISRPGSIDTFDLMTL
HPIEIARQLTLLESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VEAENVDERVAVFSRIIEILQVFQELNNFNGVLEIVSAINSVPVYRLDHTFEERRILEEA
VELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRDGKELINFSKRRKV
AEITGEIQQYQNQPYCLKVEHDIKRFFENLNPMGNMSEKEFSDYLFNKSLEIEPRNCRQP
PRFPRKTMYSLKSPGIRPVRQASGGGGTLKGHPVPLEREPPHKITFRSIAETEPETSPSL
PTSPNTPTPPQSASSDLNSVFMEHDLSSSYGNNSIFASVLLPQSKSQSVSCGSLHHLTGD
ELLKPPPLPPRQERYLFRDQGDLHTVLRKSESPPAIPPRQPPPPRLQPRVPVINGPTDGP
LPSPPPPLPRDPLPDTPPPVPQRPPEIFINYPVNMQPSPGGRFPWDFTSSPSTPNTPPGT
PSPRALAPGTPSPRVPRRPCTHSVSQPMLVHLPPPIPPRHNSTPALPKLPPKTYKRELSQ
STHTLSQPSIHTLSLVDNRDSNE
NT seq 4032 nt   +upstreamnt  +downstreamnt
atgcagcacgacttcagctccaacgaggagagcagcgcgagatggcgaggcctgttcgtt
caggcgctacgaaaggtgcagttacaagtgcatccaaacctgtctgctaaagaagacgca
ctccagcacatcgaggcgctcatactacagctcctgaacaagctgtgtgttacacagccc
agaacaatagctgatgtcgaggatcgtgtccagaagacgttcccgaatcccatcgataaa
tgggccatgtcagatgctcagtctgcgatagagaagcgcaagcgaaggaacccgctgctg
ctgcccgtcgataagatacatccactactgaaggaggttctgggttataagatcgactac
catgtgtgtctgtatattgttgctgtgctggagtacattgcagccgatatcctcaagctg
gctggaaactatgtgagcaacattcgacattatgagatcagccagcaagacatcactgtc
tccatgtgtgctgacaaggtgttaatggatatgttcgatcaggaagaggagatggggcta
gtgtctcagagtatagaggaggtgtcttcctctggtgtgctcacatatgatgaccttgta
cgtctggagatcgctgaggagcgtcagtatctgcgggaactcgatctcatcatcaaagta
ttccggcaagccttaacatccaatagcaaactcttctccactcaggatgtggagctggca
ttcagtaatattctagaggtccacgagttaacagttaagctgttgggtcttattgaggat
gccgtagaaatgacagctgatgggagtccacacccccttgtgggcagctgcttcgaagac
cttgctgaggagcaggcgtttgatccctatgagacactctctcaggacatcctctctaaa
gaatactgtcaacatttcaacacacttatgtcccgccccactgttgctctgtacttccag
tcaattgcagagggttttaaggaggcagtgcagtatgtgcttcctcagttgatgatggtt
cccgtttaccactgcatgcactactttgaactgttacagcaattgcaggagtgcagtgaa
gaccaagacgacagagagtgtttaaaacaggctcagactgcactgatcaacctacagtgc
agcattgaacgcatatatgctaaacaccaaccacggcgcaaacaaggggagccgctgtat
cggttatataatcgtgcatctcgcagcaagcaggcagcaataaagcgtatgaatgacatc
cagaggtgtattgatggctgggaaggcagagatattggccagtgctgcagccagttcatc
atggagggggcgctcctacggaccggagctaaacacgaacgacacaacttcctgttcgat
ggcctcatgataagctgcaaagccaaccagagctccaggttgccgggagcaggcagtggg
gcagagtggggcagagttcgtctgaaagagaagtttgttttacgcaagtatcgcattgta
gatcgtgaggattcgccagatttttgtcatgcatttgagctggtgggccgcgaggaaagc
ggtgcggttttcagcgcgcgttcagcggaagagaagagtgcatggatggctgccctggtc
acactgcagtaccggcccactctggaccgcatgttggacaccgtcctgcaccgtgaggaa
caagcacaaccactgagactgccgtcaccggacatctaccggtttgctatacaggattct
gaggaaaacatcgtatttgaggagggagcgcagagaaagactggaatccccattattaag
gccgggacagttgtcaagcttattgagagactgacgtaccacatgtatgcagacccaaat
tttgtgcgtacgtttctgactacataccgttctttctgtaaaccacaagacctgctcaca
ctactgattgaaaggattgagattccagagccagagccatcagaagcagaccgagaggca
ctctggaatggagagcaaccaatggcagctgagcttcagagatttcgcagagaatatgtg
cagcctgtccaactcagggttctgaatgtattccgtcagtgggtagaacatcacttttat
gactttgagaatgatcctgaactcagctgtggacttgaagaatacctcaccagcaccaca
caacttagaggtaaatcgatgcgcaagtgggtggaatctatcatcaagatcatgagacgg
naaaaacaaactcaatctaatggcatcagtcacaacatcacctttgagagcccacctcct
cctattgaatggcacatcagccgtcccgggagcattgacacctttgatctcatgaccctt
catccaatagaaattgctcgtcagttaacacttctagagtctgatctatacagagccgtt
cgtccatctgagctggtaggaagcgtttggacaaaggaagataaagagaagaattctccc
aatctgctaaggatgattagacacacaaccaatctgacactgtggtttgaaaagtgtata
gtagaggctgaaaatgtggatgagagggttgctgtattctctcgtattattgagatcctg
caggtgtttcaagagctcaataactttaatggagttttggagattgtaagtgccattaac
tcagtaccggtgtatcgtctcgaccacacgtttgaggaaaggaggattctagaggaagct
gtagaactcagtcaagatcattttaagaaatatctcgccaagctcaaatccatcaacccg
ccttgtgtacctttctttggtatctacctgactaacattctgaagactgaagagggaaat
ccagattttctaaaacgtgatggaaaagaactgatcaactttagcaaaagacgcaaagta
gcagaaatcactggagaaatccagcagtaccagaaccaaccctactgcctcaaagtagaa
cacgatataaagaggttttttgagaatctgaatcccatggggaacatgagcgagaaggag
ttttctgactacctgttcaacaagtctttagagatcgaaccacggaactgcagacagcca
cccagatttcccaggaagactatgtattctctgaagtctcctggcattcgaccagtgcgg
caagcgtcaggaggaggagggacgctgaaaggtcacccagtgccattagaacgagaacca
cctcacaaaatcactttcaggagcattgcagaaacagaacctgagacctccccttctctc
ccaacctccccaaacacacccacacctccacagtctgccagctctgacctcaactctgtg
ttcatggagcatgacctgagcagctcctatggtaacaacagcatatttgcctcagttttg
ctgcctcagtccaagtctcagtctgtgtcgtgtggcagtttacaccatttgactggggat
gagctgcttaaaccccctccattacctccccgtcaggaaagatacctcttcagagaccaa
ggtgacttgcatacagtgttgaggaagtctgaaagtcctcccgccattccaccacgacag
ccgccacctcctcgcctgcaaccacgtgttccagtgatcaatgggccaacagatgggccg
ctgccgagccctccaccccctctgccccgcgatcccctgccagacacacctccgccagtt
ccgcaacgaccaccagagatcttcatcaactacccagtgaacatgcagccatctccagga
ggccgtttcccctgggacttcaccagctcgcctagcactcccaacacccctcctgggact
ccctcaccccgtgctctggcccccggcacgccttctccacgtgtgcctcggcgcccctgc
acgcacagcgtcagtcaacccatgctggtccacctgccccctccaataccacctcggcac
aactccacccccgcgctgccaaaactgccacccaagacttacaaaagagaactctctcaa
tccacacacactctctcacagccatccatacacactctttcactagttgacaacagggac
agcaacgaataa

DBGET integrated database retrieval system