KEGG   Cyprinus carpio (common carp): 109051867Help
Entry
109051867         CDS       T05134                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00480  Glutathione metabolism
ccar00980  Metabolism of xenobiotics by cytochrome P450
ccar00982  Drug metabolism - cytochrome P450
ccar00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109051867
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109051867
   00982 Drug metabolism - cytochrome P450
    109051867
   00983 Drug metabolism - other enzymes
    109051867
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ccar02000]
    109051867
Enzymes [BR:ccar01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109051867
Transporters [BR:ccar02000]
 Other Transporters
  Pores ion channels [TC:1]
   109051867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG DUF4419
Motif
Other DBs
NCBI-GeneID: 109051867
NCBI-ProteinID: XP_018924903
LinkDB All DBs
Position
5
AA seq 155 aa AA seqDB search
MAETVHMIDSEVFLAFSTYATIVVLKMMLMSLMTSYFRLTKQVFSNLEDTNLAKTTEDRK
KLVRVDPDVERVRRCHLNDLENIVPFVVIGLLYALTGPDLSMALLHFRVFVGSRFIHTVA
YVMALPQPTRALAFGVGLFITFSMAYRVLTTALFL
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaactgtgcacatgattgacagcgaggttttcctggccttctccacatacgca
accatagtcgtcctcaaaatgatgctcatgagcctcatgacctcatactttcgcttgaca
aaacaggttttttcaaacttggaggacaccaacttagcgaagaccacagaagacaggaag
aagctggtcagggtggatccggatgtggaaagagtgcgacggtgccatctgaatgacttg
gaaaacattgttccctttgtggtgattggtcttctgtatgcactcacggggcctgatctc
tccatggctctgttgcacttccgggtgtttgtggggtcacgtttcatacacacagtggcc
tatgtgatggcactgccccagcctaccagagctctggccttcggtgtggggctgttcata
actttttctatggcttaccgggtgctcaccacagctctttttctctaa

DBGET integrated database retrieval system