KEGG   Cyprinus carpio (common carp): 109054551Help
Entry
109054551         CDS       T05134                                 

Gene name
gad1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00250  Alanine, aspartate and glutamate metabolism
ccar00410  beta-Alanine metabolism
ccar00430  Taurine and hypotaurine metabolism
ccar00650  Butanoate metabolism
ccar01100  Metabolic pathways
Module
ccar_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109054551 (gad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109054551 (gad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109054551 (gad1)
   00430 Taurine and hypotaurine metabolism
    109054551 (gad1)
Enzymes [BR:ccar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109054551 (gad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS GxGYxYP_C
Motif
Other DBs
NCBI-GeneID: 109054551
NCBI-ProteinID: XP_018927352
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MAASSSSSSSSSGGVPDPNSTNLRPPSSNSDWSGVAHGCTRKLGMKICGFLQKNNNVDDK
SRIVRFFNDQQPRSILTRDNERDPRFRRTETDFSNLYARDLLPAKNGEEYTMQFLLEVVD
ILTNYVRKTFDRSTKVLDFHHPHQLLEGMEGFSLELCDQPESLEQILVDCRDTLKYGVRT
GHPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQLTLKKMREIIGWPNG
EGDGIFSPGGAISNMYSVMVARYKHYPEVKIKGMTAAPRLVLFTSEHSHYSIKKASAVLG
FGTENLILLRTDERGRVIPADLENKVIDAKQKGFVPMFVNATAGSTVYGAFDPINEIADI
CEKYSMWLHVDGAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVPLQCSAILVREKG
LLQGCNSMCAGYLFQPDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKSKGTIGFEKHIDR
CLELSEYLYHKIKNREGYEMVFEGKPQHTNVCFWYIPPSLRLLPDGEEKRQRLHRVAPKI
KAMMMECGTTMVGYQPQGDKVNFFRMVISNPAVTRSDIDFLIDEIERLGQDL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcgtcctcctcctcctcctcctcctctggcggcgttccggatcccaactcg
acaaatttacggccaccatcctcaaactctgactggagtggagtcgcgcatggatgcacg
aggaaacttggaatgaagatatgcgggtttttgcagaagaacaataatgttgacgacaag
agccgaattgtcaggttttttaacgaccagcagcccaggagcattttaacacgggacaac
gagcgagaccctcgcttcagacgcacagagacagacttctccaatctgtatgcgagagat
ctgcttcctgctaaaaatggtgaggagtatacgatgcagttcctgttggaggtggtggac
atactcactaactatgtgcgcaagaccttcgacagatccacaaaagtgctggacttccat
catccgcaccagctgctggagggaatggagggcttcagcttagagctgtgtgatcagccg
gagagtctggagcagatcctggtggactgcagggacacgctcaaatacggcgtccgcaca
ggtcacccaaggttttttaaccagctgtcttcaggtctagacatcattggtttagctgga
gagtggctgacctctaccgccaacactaacatgttcacatatgagattgcacccgtgttt
gtactgatggaacagctcaccctgaagaaaatgcgagagatcattggctggccaaatgga
gagggcgatggcattttctcaccaggaggagcgatctcaaacatgtacagcgtgatggtg
gcacggtacaaacactaccctgaggttaaaatcaaaggcatgacagcggctcccagactg
gtgctgttcacctcagaacatagtcactactctataaagaaggccagtgcagtgctgggt
ttcggcacagagaatctgatcttgctgaggacagatgagagaggtagagtgattccggct
gatctggagaacaaagtcattgatgccaaacagaaggggtttgtgccaatgtttgtgaac
gctacagctggatctacagtgtacggagcctttgatccaatcaatgagatcgctgacatc
tgtgagaaatacagcatgtggcttcatgtggatggagcgtggggtggaggtttgctgatg
tctagaaaacatagacacaaactgaatggcattgagagagcaaactctgtcacatggaac
ccacacaagatgatgggtgttccactgcagtgctctgccattctggtccgagagaagggt
cttctgcagggctgcaactccatgtgtgctggttatctctttcagccggataagcagtat
gatgtcacctatgacacaggggacaaagccatacagtgtggccgccatgtagacatcttc
aaattctggcttatgtggaagtcaaaaggcactataggctttgagaagcacattgacaga
tgtctggagctgtctgagtatctctaccacaagataaagaaccgagaaggatatgagatg
gtgtttgaagggaagccccaacacactaatgtgtgtttctggtacattcctccaagcctg
aggcttctgccagatggagaggagaaaagacaaaggcttcatagggttgcccccaagatc
aaggcaatgatgatggagtgtgggacaacaatggtgggctatcagcctcaaggtgataag
gtcaacttcttcagaatggttatctctaatccggctgtaaccaggtctgacattgacttc
ctgatcgacgagatagaaagactgggacaggatttatag

DBGET integrated database retrieval system