KEGG   Cyprinus carpio (common carp): 109055459Help
Entry
109055459         CDS       T05134                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109055459
Enzymes [BR:ccar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109055459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 109055459
NCBI-ProteinID: XP_018928222
LinkDB All DBs
Position
Unknown
AA seq 783 aa AA seqDB search
MPGERLSIRDNSAVGRFHGVSASNGQAVPERQSESKMKKEESGCRRWFRRACPCCFRRQN
SSNDVTSDNEGVAVGGGENEGPTSPITATGDTELDELTLAVRSVNLLSRKSDRNKKEHHT
DQYHSDQLIVRRGQTFQIELDLSRTFNPNTDKLHLELKTGPLPQVSKKTHIIIPLVDELE
DERWEAKIVEQNINRVKLSVNSPVTAVIGKYKLTITTQCLKTGETTTHDSDKDIYMLFNP
WCEDDTVYMESEKELKEYVLNDTGRIYYGTEKQIGARTWNFGQFDEGILEACLFVLDNSE
VPPSGRGDPVNVVRVISAMINSPDDRGVLEGNWSGNYAGGTSPTAWSGSVEILRQYHREG
GTPVKYGQCWVFSGVTTTVLRCLGIPTRSVTNFQSAHDTDVSLTTDVYFDENMEPIHHLN
SDSVWNFHVWNDCWMARPDLPPGMGGWQAVDSTPQETSHGTFRCGPASLAAIRSGQVYLK
FDTPFVFAEVNSDKIYWQRNPDSTFSQIHSEKKAVGHCISTKAVGSDERVDITHLYKYPE
DSEEERIAVETACRYGSKPEIYSSPIAEDVRVEVMMEGEGPRMGGDAQLKIVVKNTSSQP
RRTTLHSQVAVMYYTGVLKDTVKKDTLNVELKPQEEKTIDWVLPYTQYQNQLVDQAALML
TLSGRVSETQQVLASQTSFRLRTPDLQIEPIGEAYVGKETSAKITFTNPLPCVLRNVVIR
VEGLGLRDLHPIRVGDVSKHANVTVTEHFIPTIAGKRKLVASLECKQLSQVHGVADIDVY
ESQ
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgccaggagagagactgtcaatccgagataactctgctgtcggccgtttccacggtgtt
tctgccagcaatggccaggccgtcccagagagacaaagcgagtccaaaatgaagaaagaa
gagagcggatgccgccgttggtttcggagggcttgtccgtgttgcttccggcgtcagaac
agctcgaatgatgtgaccagtgacaatgaaggtgtggctgtcgggggcggagagaatgaa
gggcccacgtctccgattactgccactggagatacagagctggacgagttgactctagca
gtgcgttctgtgaacctgctcagccggaaatccgatcggaacaagaaggagcatcacacg
gatcaataccacagcgaccagctcatcgtccgcagaggccagactttccaaatagagctc
gacctctcacgaactttcaatccaaacacagataaacttcacttggaactgaagacaggg
ccgctcccgcaggtgtcgaagaagacacacatcatcataccgctggtggacgagctcgag
gatgaacgctgggaggccaagatcgtggagcagaatatcaaccgggtcaagctgtccgtc
aactcccccgtcactgctgttattgggaagtacaagctgaccatcacaacgcaatgcctg
aagacgggcgaaaccaccacgcatgactccgacaaagacatttacatgctcttcaatccc
tggtgtgaagatgacacagtgtacatggagagtgagaaagagctgaaggagtatgtctta
aatgacactggaagaatctactatggcactgagaagcagatcggagctcgtacatggaac
ttcggccagtttgatgaaggaattctagaggcctgtctgtttgtgctggataatagcgag
gttcctccctcgggtagaggagatcctgtcaatgtggtccgagtcatttctgccatgatc
aattccccggatgaccgtggagtgctggagggaaactggtctggaaattacgccggtggg
acgtctcccacggcctggagtggaagtgttgaaatcctcaggcaataccacagagaagga
ggaacacctgtcaaatacggccagtgctgggtgttttctggggtcacgaccacagtattg
agatgtttagggattcctacccgttccgtaactaatttccagtctgcccatgatacggat
gtgtccttgaccacagatgtgtattttgatgagaacatggaaccaatccatcatctcaac
tcggactctgtatggaacttccatgtgtggaatgactgctggatggcccgtccggatctg
cctcctggtatgggtggctggcaggccgtggattccacaccccaggagaccagtcacggg
acgttccgctgtggcccggcatcactggccgctatccgctctggacaggtgtaccttaaa
tttgacacacctttcgtctttgctgaggtgaacagcgataagatctactggcagaggaac
ccggacagcaccttcagtcagatccacagtgagaagaaagcagtcggccactgcatcagc
actaaggcggtgggctcagacgagcgtgtcgacatcacacacctttacaaatatcctgaa
gactcggaggaggagcgtatcgccgtggaaactgcctgtcgctatggcagtaaacccgaa
atctactccagtcccattgctgaggacgtgcgggtggaggtgatgatggagggagaaggt
ccacgcatgggaggagacgctcagctgaagatcgtggtgaagaacaccagctctcagccg
cgcagaaccaccctccacagccaagtggcagtcatgtactacaccggcgtgctgaaggac
accgtgaagaaggacacgcttaatgtggagctcaagccacaggaagagaagaccattgac
tgggtgctgccatacacacagtatcagaatcaactggttgaccaggccgcgctcatgctg
accctatcgggacgggtcagtgagacccagcaggttttggccagtcagaccagctttagg
ctccgaacacctgatctccaaattgagcctataggagaggcgtatgttggcaaggagaca
tccgcaaagatcaccttcacaaatcctctgccttgtgttctccgtaatgtggttatccga
gtggaaggactggggctgagagacctccatcccatcagagtcggtgatgtgagcaaacat
gccaatgtgacggtgacggagcacttcatccccacgatagcaggcaagaggaagctggtg
gcgtctctggaatgcaaacagctgtcgcaggtgcacggcgtggccgacatcgacgtttac
gaaagccagtga

DBGET integrated database retrieval system