KEGG   Cyprinus carpio (common carp): 109057220
Entry
109057220         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04114  Oocyte meiosis
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04270  Vascular smooth muscle contraction
ccar04350  TGF-beta signaling pathway
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04520  Adherens junction
ccar04540  Gap junction
ccar04620  Toll-like receptor signaling pathway
ccar04621  NOD-like receptor signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109057220
   04012 ErbB signaling pathway
    109057220
   04350 TGF-beta signaling pathway
    109057220
   04370 VEGF signaling pathway
    109057220
   04371 Apelin signaling pathway
    109057220
   04068 FoxO signaling pathway
    109057220
   04150 mTOR signaling pathway
    109057220
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109057220
  09143 Cell growth and death
   04114 Oocyte meiosis
    109057220
   04210 Apoptosis
    109057220
   04218 Cellular senescence
    109057220
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109057220
   04520 Adherens junction
    109057220
   04540 Gap junction
    109057220
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109057220
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109057220
   04621 NOD-like receptor signaling pathway
    109057220
   04625 C-type lectin receptor signaling pathway
    109057220
  09152 Endocrine system
   04910 Insulin signaling pathway
    109057220
   04912 GnRH signaling pathway
    109057220
   04914 Progesterone-mediated oocyte maturation
    109057220
   04916 Melanogenesis
    109057220
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109057220
   04270 Vascular smooth muscle contraction
    109057220
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109057220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109057220
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109057220
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109057220
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109057220
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109057220
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109057220
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109057220
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Choline_kinase FTA2
Other DBs
NCBI-GeneID: 109057220
NCBI-ProteinID: XP_018929972
LinkDB
Position
6
AA seq 392 aa
MAESGSSAAAAGAAGSSGSAAGAGAAVAVGGANGAAGPKPGLESVKGQNFDVGPRYTDLQ
YIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDI
LRARRIEYMRDVYIVQDLMETDLYKLLKTQQLSNDHVCYFLYQILRGLKYIHSANVLHRD
LKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSI
DMWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPTQDDLNCIINMKARNYLQALPQ
KPKIPWNKLFPKADNKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPSDEPVAEEPF
TFNMELDDLPKEKLKELIYEETARFQATYQGS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggaatcgggcagcagcgcggcggcggccggagccgcgggctcgagtggcagcgcc
gccggggctggagcagccgtcgcggtcgggggagctaatggagcggcgggacccaagccc
ggcctggagtcggtgaagggacagaattttgacgttggcccccgatacaccgacctccag
tacatcggggagggggcctatgggatggtctgctcagcttttgataatgtgaataagatc
cgagtggccattaagaagatcagtccgtttgaacaccagacctactgccagcgcaccctg
agggagatcaaaatcctcctgcggttccgtcatgagaacatcatcggcatcaatgacatc
ctgagagcgcgtcgcatcgagtatatgagggatgtctacatcgtacaggacctgatggag
accgacctttacaaattgctgaagacacagcaactcagcaacgaccatgtctgctacttt
ctgtaccagatcttgcgagggctgaagtacattcactctgccaatgtgctgcacagagac
ttgaagccgtcaaaccttctcatcaacaccacctgtgacctcaagatctgtgactttggg
ctggcacggatagccgacccagaacatgaccacaccggattcctcacagagtatgtggct
actcgctggtaccgtgctcctgagatcatgctcaactccaagggctacaccaagtctatt
gatatgtggtctgttggttgcatcctagctgagatgttgtccaacagacccatcttccct
ggaaagcattatctggaccagctcaaccacattttgggtattttgggctcccccactcaa
gatgatctgaactgcatcatcaacatgaaggccaggaactacctccaggctctaccccag
aaaccaaaaatcccatggaacaagctgttccccaaagcagacaacaaagctctggattta
ttggaccgcatgttaaccttcaaccccatcaaacgtataactgtggaggaagcactggcc
catccctacctggagcagtactatgacccctctgatgagccggtggctgaggagcccttc
actttcaacatggagctggatgaccttcctaaagagaagctgaaagagctcatctatgag
gagacggcacgcttccaggccacttaccagggctcctga

KEGG   Cyprinus carpio (common carp): 109057388
Entry
109057388         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase 3-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04114  Oocyte meiosis
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04270  Vascular smooth muscle contraction
ccar04350  TGF-beta signaling pathway
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04520  Adherens junction
ccar04540  Gap junction
ccar04620  Toll-like receptor signaling pathway
ccar04621  NOD-like receptor signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109057388
   04012 ErbB signaling pathway
    109057388
   04350 TGF-beta signaling pathway
    109057388
   04370 VEGF signaling pathway
    109057388
   04371 Apelin signaling pathway
    109057388
   04068 FoxO signaling pathway
    109057388
   04150 mTOR signaling pathway
    109057388
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109057388
  09143 Cell growth and death
   04114 Oocyte meiosis
    109057388
   04210 Apoptosis
    109057388
   04218 Cellular senescence
    109057388
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109057388
   04520 Adherens junction
    109057388
   04540 Gap junction
    109057388
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109057388
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109057388
   04621 NOD-like receptor signaling pathway
    109057388
   04625 C-type lectin receptor signaling pathway
    109057388
  09152 Endocrine system
   04910 Insulin signaling pathway
    109057388
   04912 GnRH signaling pathway
    109057388
   04914 Progesterone-mediated oocyte maturation
    109057388
   04916 Melanogenesis
    109057388
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109057388
   04270 Vascular smooth muscle contraction
    109057388
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109057388
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109057388
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109057388
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109057388
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109057388
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109057388
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109057388
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109057388
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase NDUF_B4 Kdo FTA2
Other DBs
NCBI-GeneID: 109057388
NCBI-ProteinID: XP_018930168
LinkDB
Position
6
AA seq 258 aa
METDLYKLLKTQQLSNDHVCYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICD
FGLARIADPEHDHTGFLTEYVATRWYRAPVDHAQLLRHVRGYTKSIDMWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPTQDDLNCIINMKARNYLQALPQKPKIPWNKLFPKAD
NKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPSDEPVAEEPFTFNMELDDLPKEKL
KELIYEETARFQATYQGS
NT seq 777 nt   +upstreamnt  +downstreamnt
atggagaccgacctttacaaattgctgaagacacagcaactcagcaacgaccatgtctgc
tactttctgtaccagatcttgcgagggctgaagtacattcactctgccaatgtgctgcac
agagacttgaagccgtcaaaccttctcatcaacaccacctgtgacctcaagatctgtgac
tttgggctggcacggatagccgacccagaacatgaccacaccggattcctcacagagtat
gtggctactcgctggtaccgtgctcctgtagatcatgctcaactcctaaggcatgtccgt
ggctacaccaagtctattgatatgtggtctgttggttgcatcctagctgagatgttgtcc
aacagacccatcttccctggaaagcattatctggaccagctcaaccacattttgggtatt
ttgggctcccccactcaagatgatctgaactgcatcatcaacatgaaggccaggaactac
ctccaggctctaccccagaaaccaaaaatcccatggaacaagctgttccccaaagcagac
aacaaagctctggatttattggaccgcatgttaaccttcaaccccatcaaacgtataact
gtggaggaagcactggcccatccctacctggagcagtactatgacccctctgatgagccg
gtggctgaggagcccttcactttcaacatggagctggatgaccttcctaaagagaagctg
aaagagctcatctatgaggagacggcacgcttccaggccacttaccagggctcctga

KEGG   Cyprinus carpio (common carp): 109082573
Entry
109082573         CDS       T05134                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04114  Oocyte meiosis
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04270  Vascular smooth muscle contraction
ccar04350  TGF-beta signaling pathway
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04520  Adherens junction
ccar04540  Gap junction
ccar04620  Toll-like receptor signaling pathway
ccar04621  NOD-like receptor signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109082573 (mapk1)
   04012 ErbB signaling pathway
    109082573 (mapk1)
   04350 TGF-beta signaling pathway
    109082573 (mapk1)
   04370 VEGF signaling pathway
    109082573 (mapk1)
   04371 Apelin signaling pathway
    109082573 (mapk1)
   04068 FoxO signaling pathway
    109082573 (mapk1)
   04150 mTOR signaling pathway
    109082573 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109082573 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    109082573 (mapk1)
   04210 Apoptosis
    109082573 (mapk1)
   04218 Cellular senescence
    109082573 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109082573 (mapk1)
   04520 Adherens junction
    109082573 (mapk1)
   04540 Gap junction
    109082573 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109082573 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109082573 (mapk1)
   04621 NOD-like receptor signaling pathway
    109082573 (mapk1)
   04625 C-type lectin receptor signaling pathway
    109082573 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    109082573 (mapk1)
   04912 GnRH signaling pathway
    109082573 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    109082573 (mapk1)
   04916 Melanogenesis
    109082573 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109082573 (mapk1)
   04270 Vascular smooth muscle contraction
    109082573 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109082573 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109082573 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109082573 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109082573 (mapk1)
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109082573 (mapk1)
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109082573 (mapk1)
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109082573 (mapk1)
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109082573 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 109082573
NCBI-ProteinID: XP_018952978
LinkDB
Position
9
AA seq 369 aa
MATAAVSAPAGGGPNPGSGAEMVRGQAFDVGPRYSNLSYIGEGAYGMVCSAYDRDNKVRV
AIKKISPFEHQTYCQRTLREIKILLRFKHENIIGINDIIRTPTIDQMKDVYIVQDLMETD
LYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLA
RVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGK
HYLDQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNRLFPNADPKALDLLD
KMLTFNPYKRIEVEEALAHPYLEQYYDPTDEPVAEAPFKFDMELDDLPKETLKELIFEET
ARFQPGYRP
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtatctgcccctgctggcggcggcccgaaccccggatccggtgcc
gagatggtccgcggtcaggctttcgacgtcgggccgcgctacagcaacctctcgtacatc
ggagaaggcgcatacggcatggtttgctcggcgtatgatcgtgataataaagtgcgtgtg
gcgataaagaaaatcagtccgtttgagcaccagacgtactgtcagcgcacactccgtgag
attaaaatcctgctccgcttcaagcacgagaacatcatcggcatcaacgacatcatccgc
accccaaccatcgaccagatgaaagacgtttacattgtacaggatctgatggagacagac
ttgtacaagctgttgaagacgcagcacttgagcaatgaccacatctgttacttcctgtac
cagatcttacgtggcctaaagtacatccactcagcaaacgttctccacagagacctgaag
ccatctaacctgttgctcaacactacttgcgacctcaagatctgtgattttgggctcgcc
cgggtggccgatccagaccatgaccacactggcttcctgacggagtatgtagccacgcgt
tggtaccgtgcaccagagattatgctcaattccaagggttacactaagtccattgatata
tggtcggttggttgcattctggctgagatgctttcgaacagacccatcttccccgggaaa
cactatctggaccagcttaaccacatcttaggtattttgggctccccctctcaggaggat
ctcaactgcattatcaacattaaggcaagaaattacctgctgtcacttcctctgcgctgc
aaagtgccctggaaccgcctgtttcctaatgcagaccctaaagcattggacctgttggat
aagatgttgacctttaacccttataagaggattgaggtggaggaggcgctggctcaccca
tatctggaacagtactatgaccccacagatgagcctgttgcagaggctccatttaagttt
gatatggagctggatgacttgcccaaagagactttgaaagagctgatctttgaagaaact
gcacgcttccaaccaggctacagaccatag

KEGG   Cyprinus carpio (common carp): 109084529
Entry
109084529         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04114  Oocyte meiosis
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04210  Apoptosis
ccar04218  Cellular senescence
ccar04261  Adrenergic signaling in cardiomyocytes
ccar04270  Vascular smooth muscle contraction
ccar04350  TGF-beta signaling pathway
ccar04370  VEGF signaling pathway
ccar04371  Apelin signaling pathway
ccar04510  Focal adhesion
ccar04520  Adherens junction
ccar04540  Gap junction
ccar04620  Toll-like receptor signaling pathway
ccar04621  NOD-like receptor signaling pathway
ccar04625  C-type lectin receptor signaling pathway
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
ccar04912  GnRH signaling pathway
ccar04914  Progesterone-mediated oocyte maturation
ccar04916  Melanogenesis
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109084529
   04012 ErbB signaling pathway
    109084529
   04350 TGF-beta signaling pathway
    109084529
   04370 VEGF signaling pathway
    109084529
   04371 Apelin signaling pathway
    109084529
   04068 FoxO signaling pathway
    109084529
   04150 mTOR signaling pathway
    109084529
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109084529
  09143 Cell growth and death
   04114 Oocyte meiosis
    109084529
   04210 Apoptosis
    109084529
   04218 Cellular senescence
    109084529
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109084529
   04520 Adherens junction
    109084529
   04540 Gap junction
    109084529
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109084529
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109084529
   04621 NOD-like receptor signaling pathway
    109084529
   04625 C-type lectin receptor signaling pathway
    109084529
  09152 Endocrine system
   04910 Insulin signaling pathway
    109084529
   04912 GnRH signaling pathway
    109084529
   04914 Progesterone-mediated oocyte maturation
    109084529
   04916 Melanogenesis
    109084529
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109084529
   04270 Vascular smooth muscle contraction
    109084529
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109084529
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109084529
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109084529
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109084529
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     109084529
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   109084529
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     109084529
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109084529
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase
Other DBs
NCBI-GeneID: 109084529
NCBI-ProteinID: XP_018954750
LinkDB
Position
Unknown
AA seq 392 aa
MAESGSSAATAGAAGSSSRAAVAGGAVAPGGANGAAGSKPGLESVKGQNFDVGPRYTDLQ
YIGEGAYGMVCSAFDNVNKIRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDI
LRARRIEYMRDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRD
LKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSI
DIWSVGCILAEMLSNKPIFPGKHYLDQLNHILGVLGSPSQDDLNCIINMKARNYLQSLPQ
KTKVPWITLFHKADNKALDLLDRMLTFNPIKRITVEEALAHPYLEQYYDPSDEPVAEEPF
TFNMELDDLPKEKLKELIYEETARFQATYQGS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggaatcgggcagtagcgcggcgacggccggagccgcgggctcgagtagccgcgcc
gccgttgctggaggagccgtcgcgcccgggggagccaatggagcggcgggatccaagcct
ggcctggagtcggtgaagggacaaaattttgacgttggcccccgatacaccgatctccag
tacattggggagggggcctatgggatggtctgctcagcatttgataatgtgaataagatc
cgagtggccattaagaagatcagtccatttgaacaccagacctactgccagcgcaccctg
agggagatcaaaatcctcctgcggttccgtcatgagaacatcatcggcatcaatgacatc
ctgagagctcgtcgcatcgaatatatgagagatgtctatatcgtacaggacctgatggag
accgacctttacaaattgctgaagacacagcatctcagcaacgaccatatctgctacttt
ctgtaccagatcctgcgagggctgaaatacattcactctgccaatgtgctgcacagagac
ttgaagccctcgaaccttctcatcaacaccacctgtgacctcaagatctgtgactttgga
cttgcacggatagccgacccagaacatgaccacaccggattcctcacagagtatgtggct
actcgctggtaccgtgctcctgagatcatgctcaactccaagggctacaccaagtccatt
gatatttggtctgtgggttgcatcctggctgagatgttgtccaacaaacccatcttccct
gggaagcattatctggaccagctcaaccacatattgggtgttttgggctccccctctcaa
gatgatctgaattgcatcatcaacatgaaggccaggaattacctccagtctctaccccag
aaaacaaaagtcccatggatcactctgttccacaaagcagacaacaaagctctggattta
ttggaccgcatgttgacctttaaccccatcaaacgtataaccgtggaggaagcactggcc
cacccttacctggagcagtactatgacccctctgatgagccggtggccgaggagcctttc
actttcaacatggagctggacgaccttcctaaagagaagctgaaagagctcatctatgag
gagacggcacgcttccaggccacctaccagggctcctga

DBGET integrated database retrieval system