KEGG   Cyprinus carpio (common carp): 109057736Help
Entry
109057736         CDS       T05134                                 

Definition
(RefSeq) trypsin-2-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109057736
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ccar01002]
    109057736
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109057736
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109057736
Peptidases and inhibitors [BR:ccar01002]
 Serine peptidases
  Family S1: chymotrypsin family
   109057736
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109057736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 109057736
NCBI-ProteinID: XP_018930524
LinkDB All DBs
Position
Unknown
AA seq 258 aa AA seqDB search
MRSLMFLVHLGAVFALVIDKIVGGYECDPYSQPWQVSLNSGYHFCSGSLVSEYWVVSAAH
CYKSRVEVRLAEHNFVVNEGPEQFISSQKVIRHPGYDSWTLDNDIMLIKLSKPATLNQYV
HPVALPSGCAAAGTMCRVSGWGINMSSTASTLQCLEILILSDLDCNIYYPFINTNTMFCA
RYLEGGNYSCQVDSGGPVVCNGELQGIMSWGYGCAEKNLQVHHLIPERRGGNFGHISRPG
SQGNVRVCWPEFKARIVD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctttgatgttcctggtgcaccttggagccgtctttgctctggtgattgacaag
attgttggtggatatgagtgcgatccctactcccagccctggcaggtgtctctgaactct
ggctaccacttctgcagtggctctctggtcagtgaatactgggttgtgtctgctgctcac
tgctacaagtcacgtgtggaggtccgtttggccgagcacaacttcgtagttaatgaggga
cctgagcagttcatctcctcccagaaggtcatccgccaccctggctatgactcttggacc
cttgacaatgacatcatgctgatcaagcttagcaagcccgctaccctcaaccagtacgtg
caccctgtggccctgcccagtggctgtgccgccgctggcacaatgtgcagagtctctggc
tggggaatcaacatgagttccactgccagcacgcttcagtgcctagagatcctcatcctg
tctgacctcgactgcaacatctactacccttttataaacaccaataccatgttctgcgct
agatacctggagggaggaaattactcttgtcaggttgactctggtggccctgtggtgtgc
aatggtgaactgcagggtattatgtcctggggttatggctgtgctgagaagaacttgcaa
gttcaccacctgatccctgaaaggcgtggtgggaattttgggcacatatccaggccgggg
tctcagggcaacgtgagagtttgctggcccgaattcaaggcacgtatcgtcgactga

DBGET integrated database retrieval system