KEGG   Cyprinus carpio (common carp): 109059335Help
Entry
109059335         CDS       T05134                                 

Definition
(RefSeq) histone-lysine N-methyltransferase KMT5B
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109059335
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109059335
Enzymes [BR:ccar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109059335
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109059335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 109059335
NCBI-ProteinID: XP_018932070
LinkDB All DBs
Position
Unknown
AA seq 810 aa AA seqDB search
MGESKNMVLNGRRHGSRFSSNQPVSKSRLQNTQRAHLRQSKGSPSARRCSRRCGGAPPEA
ERRHVPSSGMTAKELCEYDDLSTSLILDPYLGFQTHKMNTRFRPIKGRQGELREVIKLFK
KHDNLEKAFQALTAGDWTRHHFLNKTKSQEKLFKAHVFVYLRMFASDSGFEILPCNRYSS
EQNGAKIVATKDWKRNDKIEHLVGCIAELSPSEERMLLRHGENDFSVMYSTRKNCAQLWL
GPAAFINHDCRPNCKFVSTGRDTACVKVLRDIEPGEEISCYYGDGFFGENNEFCECYTCE
RRGTGAFKSKAGLPVETPVINSKYGLRETDKRLNRLKKLGESCRNSDSQSVSSNPEADSQ
EPTTVQTSLRKRTSQSCGKKHGEANAITRQTLSSPSSSTSSSKRSQTNISSLPKRLKSKP
TQSLPKGRRRCRGIWTKSSSRVSASGNLKEPSRRDADRRSSGGKGSVARPSENNQSSSKC
ASPCKDSILCPYRTRRSTRTSLGAQGADGTQASSQPSSPGVVLKSEPGELIPVTPGHQMN
TPSLETSCPKKGTCPRRRRSIKQEESGSYGESFLQEGVPDLRHAVRAADVADCGKVVLGL
PDCHQHYNGSAKSSKALRRGKGKKKRQITRYDAQLILQNNSGIPKITLRRRRDSSSSKNE
AREANSSSSSKISIKFSKEHEKDRSSSYVAKLNNGFSHGPHSSSTKLKIQLKREEDGAGL
HRTYPEDVTLGIVKREEGDVLDHNAGAQVSQSMEVESLSSEDEEEDYFDNEDDFIPLPPA
KRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgggagaatccaagaacatggtgctgaatggcaggagacatggcagcaggttctccagt
aatcagcccgtaagcaagtccaggctgcaaaacacacagagagcccatcttcgtcaaagc
aagggctccccgagtgctagaagatgcagtcgacgttgtggtggggcgcccccggaggca
gaaaggcgccatgtcccctcatcgggaatgactgccaaggagctgtgtgaatatgatgat
ctgagcaccagtttgatcctggatccttaccttggcttccagacccacaagatgaacacc
aggtttcgaccaattaaaggtcggcaaggggagctgagggaagtgatcaagctttttaag
aagcatgacaacctggaaaaagcttttcaggctttgactgctggcgactggaccagacat
cactttctcaacaagaccaagtcccaagaaaagctcttcaaagcgcatgtgtttgtttac
ctacgcatgtttgcttcagacagcggctttgagatccttccttgcaatcgctactcttct
gagcaaaacggagccaaaattgtagcaacaaaagattggaagaggaatgataaaattgaa
catcttgtgggctgcattgctgagctgtctcccagtgaagagaggatgttgcttcgacat
ggagagaatgatttcagtgtcatgtactctacacgcaaaaactgcgcgcaactctggctt
ggacctgcggcttttattaatcatgattgccggccaaattgcaagtttgtgtcaacaggc
cgagacaccgcctgcgtgaaggttttgcgggacatcgaaccgggggaagagatctcctgt
tactatggagatggattctttggagaaaacaatgaattctgtgaatgctatacttgtgaa
agacgcggaactggagctttcaagtcgaaagcagggttgcccgtggagactccggtgatc
aatagcaagtacggccttagagagacagacaagcgtctgaacagactgaagaagctgggg
gaaagttgcaggaactctgacagccagtctgtcagctccaatccagaggcagactctcag
gaaccaaccactgtacaaacatcattacgtaagaggacttcacagtcctgtggcaaaaag
cacggagaagctaacgctataacaaggcaaactctgtcaagcccttcatcttctacctca
tcctctaaacgaagtcaaacgaatatttcaagtttaccaaagagacttaaatcaaagccc
acacagtctttgcctaaaggaagacgacggtgtcgaggcatatggacgaaatcttctagc
cgagtgagtgctagtgggaatctcaaggagccctccagacgagacgcagacagacgcagc
tccggaggcaaaggcagtgtagcgcgcccatcagaaaacaatcagagctcttcgaagtgt
gcttccccatgcaaggacagcatactttgcccttacagaactcgtaggtccacgaggacc
tctctcggtgctcagggggcagacggcacacaggcatcaagtcagccatctagcccaggt
gtagtcctcaaatcggagcctggagagctcatccctgtgacaccagggcaccagatgaac
acccctagcttggagaccagctgtccaaagaaagggacgtgtcccagacgcaggaggtca
ataaaacaggaagagtccggctcctacggcgagtccttcctccaggagggcgtgcccgac
ctgcgtcacgcggttcgggctgcagatgtagcagactgtgggaaggtagtactcggcctg
ccggactgccaccagcactacaatggctcggctaaaagcagcaaggccctgcgccgaggc
aagggcaaaaagaagcggcagatcacgcgctacgatgctcagctgattctgcagaacaac
tcaggcatccccaagataacactacgccggcgtcgagacagcagcagcagtaagaacgag
gccagagaggccaactcctccagctcctccaaaatcagcatcaagttcagcaaagagcac
gagaaggaccggagcagctcgtacgtggccaagctgaacaatggcttcagccacggcccc
cacagcagctccaccaagctcaagatccagctgaagcgggaggaagacggcgcagggttg
catcgcacttacccggaggacgtcaccttaggcatcgtgaagcgagaagagggggatgta
ctggatcacaatgcgggcgctcaggtaagtcagagcatggaagtggaatcgctgtcctcc
gaggacgaagaagaggactactttgataacgaggatgatttcatcccactcccaccagca
aaacgcctgcgtctcatcgtgggcaaagattccattgacattgacatttcctccagacga
cgagaagatcagtccctcagactcaatgcataa

DBGET integrated database retrieval system