KEGG   Cyprinus carpio (common carp): 109060366Help
Entry
109060366         CDS       T05134                                 

Gene name
ace
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccar01002]
    109060366 (ace)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109060366 (ace)
   04090 CD molecules [BR:ccar04090]
    109060366 (ace)
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109060366 (ace)
Peptidases [BR:ccar01002]
 Metallo Peptidases
  Family M2
   109060366 (ace)
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109060366 (ace)
CD molecules [BR:ccar04090]
 Proteins
  109060366 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 RIFIN FixQ
Motif
Other DBs
NCBI-GeneID: 109060366
NCBI-ProteinID: XP_018933073
LinkDB All DBs
Position
Unknown
AA seq 1243 aa AA seqDB search
MQLRNNHWTGASSSERVKTDPPGTFIPALFQFLTSQLWSIMYQAVVLLTLISTSAALKPE
WKPGDYPMTVAGAESFVSDYNSTAEEVFYFSTEASWNYNTNLTDHNSQLQVSASLEEQAF
TEAWGQKAKAIFTDSLMESFTNPDLKKIIRKINVLGPANLPTAEREQYNTILSQMDSIYS
KAKVCPSSEECWSLEPELKEIMATSRSYKRLLYAWEGWHNASGVPLRSLYPEFVELSNRA
SRMDGFDDTGAYWLSWYESPTFKQDLENLFKQLEPLYQNLHAFVRRKLYDYYGPKYINLK
GPIPAHLLGNMWSQTWNNIYNMMIPFPEKPNVDVTDTMVAKGYNATHMFRVAEEFFTSLG
LLEMPPEFWDKSMLEKPSDGRDVVCHASAWDFYNRKDFRIKQCTTVTMEQLFTVHHEMGH
VEYYLQYKEQPLSFRGGANPGFHEAVGDVLSLSVSTPKHLHTIGLLDQVTDDAESDINYL
LKMALEKIAFLPFGYLIDQWRWGVFSGQTPPDRYNAEWWYLRTKYQGICPPTRRTEEHFD
AGAKYHIPGNTPYIRYFVSFILQFQIHQKLCQAAGHTGPLHKCDIYRSREAGAILEKVLK
AGSSKPWTEVLQEALGTDKMDAGPLMSYFEPVTTWLQEQNAKTGETLGWPDFNWVPPVPE
GYPEDIGQITDEMLAKQFLEEYNSTAEEVWNAYTEASWTYNTDITEANKEIMLQKNLEMA
NHTKIYGLEARKFDTSDFQDESVKRILTKLSDLERAALSEDDLIEYNNLLASMETLYSVA
TVCKNQSTCLPLDPDLNKIMAESRDYDELLFAWQGWRNASGRELRSSYKRYVELANLAAK
SNGHTDNGAFWRSLYETPTFEEDLEALWKDLEPLYINIHAYVRRALYKKYGAERINLKGP
IPAHLLGNMWAQTWSSIMDLVIPYPDATQVDATPAMIAQGWDPKRMFEESDRFFTSIGLL
PVPPEFWDKSMLEKPKDGREVVCHASAWDFYNRKDFRYKPHITVRWSILGQKRCRQRVSN
ASKQKAVPELNLCICVYYTNRMKYQGLCPPVPRTEEDFDPGAKFHIPANVPYVRYFVSFV
IQFQFHKALCEAAGQPAPLHNCDIYQSKEAGKLLGDVMKMGFSKPWPEAMTLITGQAKMS
VQPLMEYFQPLIEWLEEENKKNGDVLGWPEYDWTPYKITTQMEEKPKAVSFLGLSVDEAG
AVAGQWILLVLSIVFLLGIIYLVYRYRKTKRLQGKSMSQMELK
NT seq 3732 nt NT seq  +upstreamnt  +downstreamnt
atgcagttaagaaacaaccactggacaggagcatccagcagtgagcgtgtcaagacggat
cctcctggaactttcattcctgcacttttccagttcctcacttcgcaactgtggtccatt
atgtaccaggcagtggtgctgctgactctcatcagcacgagcgcagctctgaaacccgag
tggaaaccgggggattatcctatgacagtggccggggctgagagcttcgtgagcgactac
aactcaaccgccgaggaggtcttctacttcagcacagaagccagctggaactacaacacc
aacctgacagatcacaattcgcagctgcaggtttctgcatctttggaggagcaggctttc
acagaggcatggggtcaaaaagcaaaagctatcttcactgattctctcatggagagcttc
actaatccagacctgaagaaaatcatccgtaagatcaatgttctgggacctgccaatctc
cctactgcagagagagagcagtacaataccattctgagccagatggacagcatctactca
aaggcaaaggtgtgtccctcttcagaggaatgctggtctttggagcctgagctcaaagaa
ataatggctacctcaagaagctataagaggcttctgtatgcctgggaaggctggcacaat
gcctcaggggtcccactcagatccctctaccctgagtttgtggagctcagcaacagggca
tctcggatggacgggtttgacgatacaggcgcttactggctttcctggtacgaatctccg
acttttaagcaagacctagagaatctgtttaagcagctggaacctctctaccaaaacctg
catgcctttgttcgccgaaagctctatgactactatggtcctaaatacatcaacctcaag
ggtcccatccccgcccacctcttgggcaatatgtggtcacaaacgtggaacaacatctac
aacatgatgatcccttttcctgagaagcccaatgtagatgtgacagacacaatggttgct
aaaggttataatgctactcacatgttccgggtggctgaggagttcttcacctctctgggt
ttgcttgaaatgcctcctgagttttgggacaagtccatgctggagaaacccagtgacgga
agggatgtggtctgccatgcctctgcctgggacttctacaaccgcaaagacttcagaatc
aaacagtgtaccactgtgactatggagcagcttttcaccgtgcatcacgagatgggccat
gtggaatattacctccagtacaaagagcagccgctcagcttcaggggaggagccaaccct
ggcttccatgaggctgtaggagatgtgctgtctctgtctgtgtccacacccaaacatctc
cacaccatcggtctcctggaccaagtgaccgatgatgctgagagtgacatcaactacctg
ttgaagatggctttggaaaagattgccttccttccttttggataccttattgatcagtgg
cgctggggtgtgtttagtggacaaacaccgcctgaccgttacaatgcagaatggtggtac
ctcagaacaaaataccaaggcatctgtccaccaaccagacgtacagaggagcattttgat
gctggagcgaaatatcacattcctggaaacacaccgtacatcagatactttgtgagcttc
attctgcagttccagatccatcagaagttatgtcaggctgctggacataccggacctctg
cacaaatgtgatatctacagatcaagagaggctggagctattttagagaaagtcttgaag
gctggttcttcaaagccttggacagaagtgctacaagaggctctgggcactgacaaaatg
gacgccggccccctgatgagctattttgagccagttactacctggctgcaggaacagaat
gcgaaaacaggagagacgctgggctggcctgattttaattgggtgccaccagtaccagaa
ggctaccctgaagacattggtcaaataacagatgagatgctggccaagcaattcttagag
gaatacaacagcacagcggaggaggtctggaacgcttacacggaggcctcctggacctac
aacactgacatcactgaagccaacaaggagatcatgctgcaaaaaaacttagagatggcc
aaccacacaaagatctatggactagaggcccgtaagtttgacaccagcgacttccaggac
gagtcggtgaagcgaatcctaaccaaactgagtgaccttgagagagctgcactttctgaa
gatgatcttatagagtacaataatttgctagcatccatggagaccctgtacagtgtagcc
acagtctgcaagaatcaatcaacttgtctgcctctagatccagatctgaataagatcatg
gccgagtccagggattacgatgagctgctgtttgcctggcagggttggcgtaatgcctcg
ggcagagagctccgcagcagctacaagagatatgtggagcttgccaacttagctgcaaag
agcaatggtcacacggataatggggcattctggcgttctctgtatgaaacccccaccttt
gaagaggatctggaggccttgtggaaagatctagaaccgctctacatcaacattcatgcc
tatgtgcgcagggcactgtacaagaaatacggagcagaacgaatcaaccttaaaggaccg
attccagctcatctgctcggaaatatgtgggcccaaacgtggtcttctatcatggacctt
gtcattccgtaccctgatgccacacaagtggatgccacgccagccatgattgctcaaggt
tgggaccccaagaggatgttcgaggaatcggaccggttcttcacttctataggtcttctg
cccgtgcctcctgagttctgggacaagtccatgctggaaaagccaaaagatggacgtgaa
gtggtctgccatgcttctgcttgggacttctacaaccgcaaagacttcaggtacaagcct
catatcacagtaagatggtccatactagggcagaagaggtgtcgccagcgtgtttcaaac
gcttcgaaacaaaaagctgtaccagagctgaatttgtgtatttgtgtatattatactaac
agaatgaagtaccagggattgtgtccacctgtacctcgcactgaggaagacttcgaccct
ggtgcaaagttccacatcccagctaatgtgccctacgtcaggtactttgtgagttttgta
atccagttccagttccacaaagccctgtgtgaagctgccggtcagccagctccgctccac
aactgtgacatctaccagtccaaagaagcagggaaactcctgggtgatgtgatgaagatg
ggcttcagtaaaccctggcccgaagccatgactttgatcactggccaggccaaaatgtca
gtccagcctctgatggagtatttccagccgctcatcgagtggcttgaagaggagaacaaa
aagaacggtgacgtcctgggatggccagagtatgattggacgccttacaaaatcactaca
cagatggaagagaagccgaaagcagtcagtttcctgggtttgagtgtggatgaggcaggc
gctgtggcgggacagtggattctcctggttctgagcatcgtcttcctgcttggcatcatc
tatttagtctacagatacaggaagactaaacgcttacaaggcaaatcaatgtctcagatg
gagcttaagtaa

DBGET integrated database retrieval system