KEGG   Cyprinus carpio (common carp): 109060552
Entry
109060552         CDS       T05134                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109060552
   04068 FoxO signaling pathway
    109060552
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109060552
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109060552
NCBI-ProteinID: XP_018933265
LinkDB
Position
Unknown
AA seq 166 aa
MSMTSDACYFGLLEGQEEDIKPQAAVTRRNLFGPVDHQQLQQDFQRHFCMNVEIAKQRWN
FDFQRDQPVPGCIEWEELQCQDVPVFYHSCVVRPSMAMQTTVEACSSPAMATEKYLELRT
RGTLKGTKSEKRMAALLGVKRRQANITDFFRVTKRRFPDHKTSSGQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtccatgacatcagatgcatgttattttgggctgctggaagggcaagaggaggacatt
aagcctcaggcagcagtaaccaggcggaacctgtttggcccagtggaccaccaacagttg
cagcaagacttccagaggcatttctgcatgaatgttgagatcgccaaacagcgctggaac
tttgactttcagagggaccagccagtccccggctgcattgagtgggaggagctgcagtgc
caggatgtgccagtgttctaccatagctgtgtggtcaggcccagtatggcaatgcagaca
acagtggaagcttgttcatctccagctatggccacagagaaatatctagagctgcggacc
agaggaactttgaagggaaccaagtcagagaagagaatggctgcattgctgggggtcaaa
cgcagacaagcaaacatcacagactttttcagagtgacaaaaagaaggtttcctgatcac
aaaacttcatcaggacagtaa

DBGET integrated database retrieval system