KEGG   Cyprinus carpio (common carp): 109060735
Entry
109060735         CDS       T05134                                 

Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04510  Focal adhesion
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109060735
   04012 ErbB signaling pathway
    109060735
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109060735
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109060735
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109060735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109060735
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109060735
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10
Other DBs
NCBI-GeneID: 109060735
NCBI-ProteinID: XP_018933432
LinkDB
Position
Unknown
AA seq 310 aa
MSSARFDSSDRASWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPNKRFKIGDQEFDNLPGLLEFYKIHYLDTTTLIEPAPRYPSTPLPSVSIQPSGG
LGDENQEYVRTLYDFTGSDAEDLPFKKGEILIIQKGEILIILDKPEEQWWSAKNKEGRVG
MIPVPYVEKLVRPLPHPGQPGHGSRNSNSYGIPEPAHAYAQPQTPSPITPGAVINPLPSV
QNGPVMAKAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRRGLFPFTHVKI
LDPQNPDESE
NT seq 933 nt   +upstreamnt  +downstreamnt
atgtcgtctgcacggttcgactcctcggaccgagccagctggtatttcgggccggtttcg
agacaggaggcgcagaatagactacagggacagagacacgggatgtttttggtgcgagat
tcgtccacctgtcctggtgattatgtactttcagtgtcagaaaactccaaagtttctcac
tatatcatcaactctttgccaaacaagagattcaagataggcgaccaagagtttgataat
ctaccaggccttttggagttctataaaatacattatctggatacgaccaccctgatagag
ccagcaccaaggtaccccagtacccctctgcccagtgtttctattcagccgtccggggga
ctcggagatgagaaccaggagtatgtgcggactctttatgactttactggtagcgatgct
gaagaccttcctttcaagaagggtgaaatcctaattattcagaagggtgaaatcctaatt
attctagacaagcctgaggagcagtggtggagtgccaagaacaaagaaggccgagtaggc
atgattcctgttccttacgtagaaaagctggtgaggcctttgcctcatcccggtcagcct
ggccatggttcacgcaattccaatagctatggcatccctgagccagcacacgcctatgct
cagcctcagactccatcacccattacacccggcgctgtcatcaacccactgccttctgtg
caaaatgggccagtaatggcgaaggcgatccagaaacgagtgccatgtgcatatgacaag
actgccttagcactagaggtgggcgacattgtgaaagtgactaggatgaacatcaatggt
cagtgggaaggggaggtaaatggccggagaggtttattccctttcacccatgtgaaaata
ttggacccccaaaacccagatgagagcgaatga

KEGG   Cyprinus carpio (common carp): 109069464
Entry
109069464         CDS       T05134                                 

Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04510  Focal adhesion
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109069464
   04012 ErbB signaling pathway
    109069464
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109069464
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109069464
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109069464
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109069464
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109069464
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 SH3_10
Other DBs
NCBI-GeneID: 109069464
NCBI-ProteinID: XP_018941645
LinkDB
Position
Unknown
AA seq 302 aa
MSSARFDSSDRASWYFGPVSRQETQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPNKRFKIGDQEFDNLPGLLEFYKIHYLDTTTLIEPAPRYPSTSLPSGPIQPSGG
IGDENQEYVRTLYDFTGSDAEDLPFKKGEILIILDKPEEQWWSAKNKEGRVGMIPVPYVE
KLVRPSPQPGLGSRNSNSYGIPEPAHAYAQPQTPSPIPPITPGAVINPLPSMQNGPVMAK
AIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNGRRGLFPFTHVKILDPQNPDE
NE
NT seq 909 nt   +upstreamnt  +downstreamnt
atgtcgtctgcacggttcgactcctcggaccgagccagctggtatttcgggccggtttcg
agacaggagacgcagaataggctacagggacagagacacgggatgtttttggtgcgagat
tcctccacctgtcctggtgattatgtactgtcagtgtccgaaaactccaaagtttctcac
tatatcatcaactctttgccaaacaagagattcaagataggcgaccaagagtttgataat
ctaccaggccttttggagttctataaaatacattatctggatacgaccaccctgatagag
ccagcgccaaggtaccccagtacctctctgcccagtggtcctattcagccgtccggggga
attggagatgagaaccaggagtatgtgcggactctttatgacttcactggtagcgatgct
gaagaccttcctttcaagaagggtgaaatcctaattattctagacaagcctgaggagcag
tggtggagtgccaagaacaaagaaggccgagtaggcatgattcccgttccctatgtagaa
aagttggtgaggccttcgcctcagcccggccttggttcacgtaattccaatagctatggc
atccctgagccagcacacgcctatgctcaacctcagactccatcgcccattcctcccatc
acacccggcgctgtcatcaacccactgccttccatgcagaatgggccagtaatggcgaag
gcaatccagaaacgagtgccttgtgcatatgacaagactgccttagcactggaggtgggc
gacattgtgaaagtgactagaatgaacatcagcggtcagtgggaaggggaggtaaatggc
cggagaggtttattccctttcacccatgtgaaaatattggacccccaaaatccagatgag
aacgaatga

KEGG   Cyprinus carpio (common carp): 109103249
Entry
109103249         CDS       T05134                                 

Gene name
crk
Definition
(RefSeq) adapter molecule crk
  KO
K04438  C-crk adapter molecule crk
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04510  Focal adhesion
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109103249 (crk)
   04012 ErbB signaling pathway
    109103249 (crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109103249 (crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109103249 (crk)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109103249 (crk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109103249 (crk)
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109103249 (crk)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 109103249
NCBI-ProteinID: XP_018972168
LinkDB
Position
29
AA seq 311 aa
MAGNFDSEDRGSWYWGRLSRQDAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHY
IINSISSNRQSGPGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPINKAKHSSFI
SVSAGTGGAPQRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLEKPEEQWWNAQNSEGRV
GMIPVPYVEKYRPASPTSGGPGGSVGGSGAHGNSDGHSSQSQPLPGEPGQYAQPTSLPNL
QNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKHGHFPFTHVRL
LDQHNPEDELS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggccggaaattttgattctgaggaccgagggagctggtattgggggagattaagccgg
caagacgcggtttcgctgctccaaggacagaggcatggagtgttcctggtgcgggactcg
atcactattcccggggactacgtgctgtctgtgtcggagaactccaaagtctctcattac
ataataaacagcatcagcagcaatcgccagtccggaccaggactcgctcctcctcggttc
cgtattggagatcaggaatttgacgccttacccgccctgttggagttctacaagatccac
tacctggataccaccactctcattgagcccatcaacaaagccaagcactcgtccttcatc
agcgtcagtgcgggaacgggaggagctcctcagaggctggaagaggagtacgtccgagcc
ctcttcgacttccccggcaacgacgacgaggaccttccgtttcgaaagggcgatgttcta
agagttctggagaagccggaggagcagtggtggaacgctcagaattcagaaggccgcgtc
ggcatgatccccgtgccctatgtggagaagtaccggccggcctcaccaacatcagggggc
cctggggggtcggttggaggatctggagctcacggcaactctgacggccacagttctcag
tctcaacctctgcctggcgagccgggccaatatgcccagccgacatccttacccaatcta
cagaatggtccggtttatgccagggccattcagaagagagttcccaatgcctatgacaag
actgctcttgctttggaggtcggcgacatggtgaaggtgaccaagatcaatgtaaatggg
cagtgggagggtgagtgcaagggaaagcatggccattttccctttacccatgttcgcttg
ctggaccagcacaacccagaggacgaactgagctga

KEGG   Cyprinus carpio (common carp): 109103559
Entry
109103559         CDS       T05134                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04510  Focal adhesion
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109103559
   04012 ErbB signaling pathway
    109103559
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109103559
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109103559
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109103559
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109103559
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109103559
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 109103559
NCBI-ProteinID: XP_018972491
LinkDB
Position
29
AA seq 340 aa
MANIARTSGECCARGEGKACEAWAFSCASHGRKFDSEDRGSWYWGRLSRQEAVSLLQGQR
HGVFLVRDSITIPGDYVLSVSENSKVSHYIINSISSNRQSGPGLAPPRFRIGDQEFDALP
ALLEFYKIHYLDTTTLIEPISKAKHSSFISVNAGTGGAPQRLEEEYVRALFDFPGNDDED
LPFRKGDILRVLEKPEEQWWNAQNSEGRVGMIPVPYVEKYRPASPTSGGPGGSDRGSGAH
GNSDGHGSQSQPLLGEPGQYAQPTSLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMV
KVTKINVNGQWEGECKGKHGHFPFTHVRLLDQHNPEDELS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggcaaacatcgctcgtacatccggcgaatgctgcgcgagaggcgaagggaaggcctgt
gaagcctgggctttttcttgcgctagtcatggccggaaatttgattcggaggaccgaggg
agctggtattgggggagattaagccggcaagaggcggtttcgctgctccaagggcagagg
catggagtgttcctggtgcgggactcgatcactattcccggggactacgtgctgtctgtg
tcggagaactccaaagtctctcattacataataaacagcatcagcagcaatcgccagtcc
ggaccaggactcgctcctcctcggttccgtattggagatcaggaatttgatgccttacct
gcgctcttggagttctataagatccactacctggataccaccactctcattgagcccatc
agcaaagccaagcactcgtccttcatcagtgtcaatgcagggacaggaggagcgcctcag
aggctggaagaggagtacgtccgagctctctttgacttccccggcaatgacgacgaggac
cttccgtttcgaaagggcgatattctaagagttctggagaagccggaggagcagtggtgg
aacgcacagaattcagaaggccgtgtcggcatgatcccagtgccctacgtggagaagtac
cggccggcctcgccaacatcagggggccctggagggtctgatagaggatccggagctcac
ggcaactccgacggccacggttctcagtctcaacctctgcttggcgagccgggccaatat
gcccagccgacatccttacccaatctacagaatggtccggtttatgccagggcgattcag
aagagagttcccaatgcatatgacaagactgctcttgctttggaggtcggcgacatggtg
aaggtgaccaagatcaatgtaaatggtcagtgggagggtgagtgcaagggaaagcatggc
cattttccctttacccacgtccgcttgctggaccagcacaatccagaggacgaactgagc
tga

KEGG   Cyprinus carpio (common carp): 109103562
Entry
109103562         CDS       T05134                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
ccar04510  Focal adhesion
ccar04810  Regulation of actin cytoskeleton
ccar04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109103562
   04012 ErbB signaling pathway
    109103562
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109103562
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109103562
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109103562
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ccar04990]
    109103562
Domain-containing proteins not elsewhere classified [BR:ccar04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   109103562
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 109103562
NCBI-ProteinID: XP_018972493
LinkDB
Position
29
AA seq 267 aa
MAGNFDSEDRGSWYWGRLSRQDAVSLLQGQRHGVFLVRDSITIPGDYVLSVSENSKVSHY
IINSISSNRQSGPDFISVSAGTGGAPQRLEEEYVRALFDFPGNDDEDLPFRKGDVLRVLE
KPEEQWWNAQNSEGRVGMIPVPYVEKYRPASPTSGGPGGSVGGSGAHGNSDGHSSQSQPL
PGEPGQYAQPTSLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEG
ECKGKHGHFPFTHVRLLDQHNPEDELS
NT seq 804 nt   +upstreamnt  +downstreamnt
atggccggaaattttgattctgaggaccgagggagctggtattgggggagattaagccgg
caagacgcggtttcgctgctccaaggacagaggcatggagtgttcctggtgcgggactcg
atcactattcccggggactacgtgctgtctgtgtcggagaactccaaagtctctcattac
ataataaacagcatcagcagcaatcgccagtccggaccagatttcatcagcgtcagtgcg
ggaacgggaggagctcctcagaggctggaagaggagtacgtccgagccctcttcgacttc
cccggcaacgacgacgaggaccttccgtttcgaaagggcgatgttctaagagttctggag
aagccggaggagcagtggtggaacgctcagaattcagaaggccgcgtcggcatgatcccc
gtgccctatgtggagaagtaccggccggcctcaccaacatcagggggccctggggggtcg
gttggaggatctggagctcacggcaactctgacggccacagttctcagtctcaacctctg
cctggcgagccgggccaatatgcccagccgacatccttacccaatctacagaatggtccg
gtttatgccagggcgattcagaagagagttcccaatgcatatgacaagactgctcttgct
ttggaggtcggcgacatggtgaaggtgaccaagatcaatgtaaatgggcagtgggagggt
gagtgcaagggaaagcatggccattttccctttacccatgttcgcttgctggaccagcac
aacccagaggacgaactgagctga

DBGET integrated database retrieval system