KEGG   Cyprinus carpio (common carp): 109060827Help
Entry
109060827         CDS       T05134                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14-like
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04210  Apoptosis
ccar04625  C-type lectin receptor signaling pathway
ccar04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109060827
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109060827
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109060827
   04672 Intestinal immune network for IgA production
    109060827
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ccar01001]
    109060827
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109060827
Protein kinases [BR:ccar01001]
 Serine/threonine kinases: STE group
  Other
   109060827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 109060827
NCBI-ProteinID: XP_018933530
LinkDB All DBs
Position
6
AA seq 844 aa AA seqDB search
MPRILNSTVPFSNMAQRDIKAFNCPSLGPGSRTENKGGERDKPNQLNIWTFIHLGTADSE
WTQRTEKQSIIAQAECESQDSQEFCPNGSISSQSLLGAISRSWPKKKRHKKHRRKRGEKD
SRVSESVGVTGVPEQDSGECLSSSLIQVRDPVCISSSSNSSTYSSSGLSTERVSVQETEG
PSNSYQWESRRTSLPRLSCCQSYSQESEELQSPLRSETECSLACTALRNLVTSEDRCFAY
GFVNNVLREERERDEDEREESDKNEGILFKEGLQPVNYEYREGREYERCRFLKQGSFGEV
YSIKDKGTGFMCAAKKVPLVSFSSEEVGSWSALQSPQVVELFGVVREGPSIILFMDLKSS
SLGQLVEERGRLPEDLSLHYLQQVLGALNHLHRKRVLHLDIKADNILLSEDGKDAFLCDF
GYSERLDKQGLSYCKSLKGTETHMAPEVVLSEPRSSKADIWSSCCMLLHMLNGCHPWTRY
YSHPLYLKIAEEPPPVREIPRDCSSYTADVIRSGLQKDPNTRASAKELLVKTAKALKDVG
GLHSPVRGGTYLKPLGKPENPDSAHSATPTTSHHTTSSDNSEQQWMSSEQEKRAGDGERN
DEPDEVKERKRTEETRNDDHSPPKSLLHIQTTSPEPQIINKTEPEATVPEEELWKDFHVS
SLSHPHSAERQEQWLSCLSSDGLSSREYWDKKDSGHCSDGPRDDLSSGVFSYNSQQDGQS
FSRDWLAPTHRPPPRCFDGVNVYIRDFDGKCFHIRETPGVKVGHVARGISDQISENVFSL
RTEDGCLVPHDKEVLENSLFLRCVPALDSSHYHQYGHNPCCTLGPDCKQPWSWRIREGML
ETRD
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaattttgaactccactgtcccattctccaacatggcccaaagggacatcaaa
gctttcaactgccccagcttgggcccaggctctcgcaccgagaacaaaggaggagagcgg
gacaaaccaaatcagttgaatatctggacgttcatacatcttggaactgccgactctgag
tggacacagaggaccgagaaacaatccattattgcccaggcagagtgtgagtcccaggat
tcacaggagttctgccccaatggcagcatctcctcccagtcgcttcttggagccatctct
cgcagttggcccaaaaagaaacggcataagaaacatcggcgaaaaaggggcgagaaggac
agccgagtgagtgagtccgtgggagtcactggagtgccagaacaggacagcggcgagtgc
ctttcttcatcactcattcaggttagagatccagtgtgcatcagcagcagcagcaacagt
agtacgtacagcagcagtggcctcagcacggagagggtgtctgtgcaggaaacagagggc
ccgtcgaactcctatcagtgggagtcccggcgcacctccttacccagactctcctgctgc
cagagctacagccaagagagcgaggagctgcagtctcccctgaggagtgagactgaatgc
tctctggcttgtacggccctgaggaacttagttacaagcgaagatcgctgctttgcatat
ggctttgtcaacaatgtgctgagagaggagagggagagggatgaggacgagagagaggag
agcgacaagaatgaagggatcctgttcaaagaggggctacaaccagtgaactatgagtac
agagagggacgggaatatgaacgctgtagatttctcaagcagggctccttcggagaggtc
tacagcatcaaagacaaaggcaccggcttcatgtgtgccgccaaaaaggtgccattggtg
agtttcagcagtgaggaggtgggctcgtggagtgccctgcagtctcctcaggtggtggaa
ctctttggagtggtgcgtgaaggtccttccatcatcctcttcatggaccttaaatccagt
tctcttggacagctggtggaggaacgaggccgtctgccagaggatctatccctgcactac
cttcagcaagtattgggggcgctaaaccacctgcataggaagcgtgtccttcatctggac
atcaaagcggataatattttgctgtcagaagatgggaaggatgcattcctgtgtgacttt
ggatactcggagagattggacaaacaagggcttagttattgtaagagtctgaaaggcaca
gaaactcatatggcacctgaggtggtgctcagtgagccgcgctcctcaaaagcagacatc
tggagcagctgctgtatgctcctgcacatgctcaacggctgtcatccgtggacgcgctac
tactcccacccactatacctcaagatagcagaagagcctccgccagtgagggaaatccct
cgtgactgcagctcctatacagcagacgtcataagatcaggactgcagaaagatccaaac
acacgagcctctgccaaagaactcttggttaaaactgctaaagcacttaaagatgtgggg
ggacttcacagccccgtgagaggaggaacctatctgaagccactggggaagccagagaat
ccagactccgcccattcagccacacccaccacatcccaccacaccacgtcctctgataac
tctgagcagcagtggatgagctcggagcaggagaagagagcgggtgatggggagcgtaat
gacgagccagacgaggtgaaagagaggaaacggacagaggagacaagaaacgatgaccac
tctcctccgaagtcactgctccacattcaaaccacttcacctgagccacagatcatcaat
aagaccgagccagaagcaacagtgccggaagaagagctgtggaaagatttccacgtgagc
agcctttctcatcctcattctgctgagcgacaggagcagtggctctcttgtctcagtagc
gacggcctttcctctagagaatactgggacaagaaggattcagggcattgttcagacggt
cctagagatgaccttagctcaggcgtgttttcttacaacagccaacaagatggccagagc
ttcagcagggactggcttgcccccacacatcgacccccgccccgctgctttgacggggtg
aatgtttatattagggactttgacgggaaatgctttcatattcgggagacgcctggggtg
aaagtaggccacgttgcaagaggaatcagcgatcagatctcagagaacgtgttcagtctg
cgaacagaggatggttgcttggtgccccatgacaaagaggtcctagagaacagcctgttt
ttgcgctgcgtcccggcccttgactccagccactatcatcagtacggacacaacccctgc
tgcaccctcggccccgactgcaaacagccatggagctggaggatcagagaggggatgctg
gagactagagactga

DBGET integrated database retrieval system