KEGG   Cyprinus carpio (common carp): 109063165Help
Entry
109063165         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase SETD2-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109063165
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ccar03036]
    109063165
Enzymes [BR:ccar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109063165
Chromosome and associated proteins [BR:ccar03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109063165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 109063165
NCBI-ProteinID: XP_018935781
LinkDB All DBs
Position
Unknown
AA seq 2472 aa AA seqDB search
METLLNQELRKDVKDCSIKVENLPKQVIFKGLAPRVILTNHLLPKGTKAKVNLEEQGRQK
ISFSFAQTKKPRQNVFLAPPSPEKSASEHSSALQAGPVPTPDLAGQSDETKNVDTDTPAE
VGETQAAPAPVSFPLKSKPVLGKIHFKKQILSVTVVEDNSIVTTTSAEISEPAVPSESDK
IRSSAKIETETSLQQPHKNSVIDSSSEKVLKEENPQEKVDSCLKGPVLKGPVSSHIGKGD
KDTSVISEHEENRKSQSRSDTTLPGSESDGDSIRTSSSQKSSDRRNKIKSECPSNEAKRS
SNSKTEEAEKSRHDRKEDEKGSSRSKSERDSRHTSSRSSRSDRDRRRTKSRSRSRSRGCR
NSSYSRSERSRSERQSRSDRSHYHDSERRFHRSSPHRERRGSRSRTDGRSRDSSDSEDDH
RRTRTRGSDSSRSSTYSSSQKDSKSATHSRSHRDSKPTDCSRSSEADKRTQHSKSERSHL
KAGDSESNRKSSPDAEAVHRKSSRPLQNLRLMTKTSNSNPATSSRTSEKKVHKNSSDSDE
EHRKRRRSQGSDKSSMSGNSSSKKTNLKNHKTLNNVTGTERQSKDRSSNNTKQSQLSPSP
VTPQKECSKIDDNATLPKSKCISQQMHEATHKVNLFKTNQQTEQQAPNQELSSLGKCTNV
PEKESTSTTSRSLEVRSSTDEPVMNNEIPIQSKALAEGTTDSFCEGHTPDQDSEGSLADP
LSVKELPPGGCLKFNTKLDGPSHITQSAELCEIDSEQHYVNPEQPSSGILKKDSSAKKSR
WDIVGQATSENQSPPKIVSPDVKKDISVKRIELNNDTTPEESCTQNQDSEVPVEKQIQDT
TSAESHQKLSSRASDLETQHIHGELIKQIFEDPQSTSAPVVSDLLLNCISGSKEKINVDK
PKPETQDPDSLNHDGKCHSEDSESEESDSDSDDGRVSLKRLHSVVVVPKNSTIALETNDL
TEPSPGFSVFSGQQQTDKHESINREFAYGFNNQSKLEESSAALFKASAQAAMLNLDIKRV
SYQSQSNMIDSTSHSESTIAHVDKNWSAQERPNSVQINQASLQSFEKTLQPESDHHQNHD
RPESWNGRKGGKQHYGESTDFNSGKGYGLAWDFNQSEQPSSTFQQPDSSHGTDHPPQPGI
ALFDSGQRQGPWTQPAISKTNRPVNAHVPFQYHDSVNQIHPDSLTNDHDDDRVVGIKQGS
ILSADLPGSSPFVQAHEISSNCSFTTESQNISEAPREDNQKPHRGRGPPKKRRQEFESES
DNEAEAGLSSKRVCLDESSRVVKDGKESFHQIQEVARPLLSLKEFVDPAVWREKAKQKKM
PPYFDLIEENLYLTERKKNKSHRDIKRMQCECAILSREERARGMMACGEDCLNRLLMIEC
SSRCLNGAYCSNRRFQMKQHADFEVILTESKGWGLRAAKDLQPNTFVLEYCGEVLDHREF
KARVKEYARNKNIHYYFMALKNNEIIDATLKGNCSRFMNHSCEPNCETQKWTVNGQLRVG
FFTTKAVTAGTELTFDYQFQRYGKEAQKCFCGAPSCRGLIGGETRVSVRAAGGKKQRERS
RKKDTDSALTTLDEELEALQENGEGLCGEKDVISLCRLMVRVETMEQRLTCLKLIQNTQN
PLCLKQFLDHHGLSLLWIFMVELSEAKSNSVNNIKLQLEIMKALAVLPISTKNMLEESRV
LQFIQRWAQSRPLSQPAEQDGYSSESTSRAQTPLNTPDGPPAKLASELDGDTPKRAVYRR
LKIISENSLDSAMSDASKASDGKEEEDEEEEEMEDETSQLEATIEREVKVENSEAPSESH
AEPEPELKQEPPETEEVTHSTPEATGSEGEPLETQEPEEKPIIKPEEQLEDEKIVEETKS
EEPSESQTESATVEDASPVTDTTSAADISNDVVAEVETPMAETQVENASSEQCSSEGNES
CSTAEITPTQPSETIMESVSSESTAVAIESAPTESLPASEETTPPETAAVSTENISSEAA
VAAGSADAPTLAIVAVPAEGAAVGTPSQDEEEGVSDVESERSQEPQVQASDISDMAARLL
DSWKDLKEVYRIPKKSQVEKESSDRSRDREALMTPRTPSSSREREREREKERDRDRDRDR
DRDWERERDWDRERDRERDGERSSLRSADRKRRRGSTSPLPPSAYERGRRNDDRLLKYSY
LNTVILYIHCVYFSGCYTTLWDPNTQQAVTVQTQPTQQYSTTAQPQTAIYYQGQPCQTIY
SIPAGYPQTNTPVIQTYTEPAASYLHGQQVYTGHQQGVVVQQGGTVTTIVTSQTVQQEMI
VPNSIIDLPXPSPPKPKTIILPPSWKVARDPEGRIYYYHIITRQTQWDPPNWDGTTEEAS
LEHEAEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKP
DCKLGRISNTEDFKHLARKLTHGVMNKELKSCKNPEDLECNENVKHKTKEYIKKYMQKFG
TVYRPKEDTELD
NT seq 7419 nt NT seq  +upstreamnt  +downstreamnt
atggagactctgttgaatcaagagctcaggaaagatgtgaaagattgttcgatcaaggtt
gaaaacctcccgaagcaagtcatattcaaaggccttgcacctagggtcatattgacaaac
catctcctgcctaaaggaaccaaggcgaaggtaaaccttgaggaacagggtcgacaaaag
atctccttcagcttcgcacagacaaagaaaccacgtcaaaatgtatttctagccccacca
agtccggagaaatctgcaagtgaacattcttctgcactgcaagctggacctgtacctact
ccagatctagcaggacagagtgatgaaaccaagaatgtggatacagatactccagcagaa
gttggggagacccaggcagcacccgccccagtatccttccctctcaaatcaaaacctgtt
cttggaaagatccattttaagaaacagattctcagcgttactgttgttgaggataactcc
attgtcaccaccacctcagcagagatttcagagccagcagtcccatctgagtcagacaaa
attagatcttcagccaagattgaaactgaaacctcattgcaacagcctcacaagaactca
gtcattgatagttcctctgaaaaagttctcaaagaggaaaaccctcaggagaaagttgac
tcatgccttaaaggtcctgttcttaaaggtcctgtttcttcccatattgggaagggagat
aaggatacttccgttatttctgagcatgaggaaaacagaaaatcacaatctcgatcagat
accacgcttccaggttcagaatctgatggggattcaatccgaacatcatctagccagaag
tctagtgaccgcagaaataagataaaatctgaatgtccaagtaacgaagcaaaaagatcc
tcgaattccaaaactgaggaggcagaaaaatccaggcatgataggaaagaagatgaaaag
gggtcaagtcgttcaaaatctgagcgcgactccaggcacacatcgtcaagatcttctcgt
tctgacagagacagaagaaggaccaaaagtcggtcaaggtctagatctcgaggctgtcga
aatagttcctattccaggtctgaaagatccaggagtgagagacagtcaaggtcagatagg
tcacattaccatgattctgagcggaggtttcatagaagttctcctcatcgtgaaaggaga
ggctcacgttcacgaaccgatggcaggtctcgtgacagctctgactcagaagatgaccac
cggaggacaaggactcgaggtagtgactcaagtcgatcctccacttactctagctcgcaa
aaagactcaaaatcagccactcactccagatcccacagggactcaaaacccacagattgt
tctcgatcatctgaagcagacaaaagaacacagcattcaaagtcagaacgatctcattta
aaagctggtgactctgaatccaatagaaagagctctcctgacgcagaagcagttcacagg
aaatccagtcgcccactacaaaatctgagattaatgactaaaacctcaaattctaaccca
gctacctcatcccgaacatctgagaaaaaggtccataaaaacagctctgactctgatgag
gagcacagaaaaagacgtcggtcacaaggatcagacaagtcatccatgtctgggaattca
tcttccaaaaaaacaaacctcaagaatcacaagactttaaataatgttactggtacagag
agacaatcaaaagacagatcaagtaataacacaaagcagtcacagttatcccccagccca
gttactcctcagaaggaatgcagcaaaattgatgacaacgctactctgcctaaatctaaa
tgcatttctcaacagatgcatgaagctacgcacaaagttaatttgttcaaaacaaatcaa
caaactgagcaacaagctccaaaccaagaacttagtagtttgggaaagtgcacaaatgtt
cctgagaaggaatccacttccacgacaagtagaagtcttgaagttagaagttccactgat
gaacctgtaatgaacaatgagattccaatccaaagtaaagctctggcagaaggaacgact
gactcattttgtgaaggtcacactcccgatcaggattcagaaggatcgctagcagaccct
ctttctgtgaaagaattaccacctggaggatgcttgaaatttaacactaaattagatggg
ccatcgcacatcacacagagtgctgaactctgtgaaatagattctgagcagcattatgtg
aatcctgaacaacccagtagtgggattttgaaaaaggatagtagtgctaaaaaatcccga
tgggacattgttggtcaagctacttcagaaaatcaaagccctccgaaaatagtgagtcca
gatgtgaaaaaggacatctcggtaaaaagaatagagttgaacaatgatactacccctgaa
gaatcttgtacacagaaccaggactctgaagtaccagtagaaaaacaaatacaagacaca
acctcagctgaatctcatcagaaattaagttctcgtgcgtctgaccttgaaacccaacat
attcatggtgaacttataaaacagatctttgaagatcctcaatcaacaagtgcccctgtt
gttagtgatcttctccttaattgcatttctggcagtaaagagaaaatcaatgtagacaaa
cctaagcctgaaactcaagaccccgattccttaaaccatgatggtaaatgccacagtgag
gatagtgagagtgaagaatcggactcagattcagatgatgggcgtgtttccttaaagcgg
ttgcactctgtggtggttgtgccaaaaaattcaaccattgctcttgagacaaatgacttg
actgaaccgtctcccgggttctccgtgttttctgggcagcaacagactgataagcatgaa
agcattaatagggaatttgcttatggctttaacaatcagtcaaagcttgaggaatcatca
gctgcactttttaaggccagtgcgcaagctgcaatgctaaatctagatattaaacgtgtc
tcctaccaatcacagagcaacatgattgacagtaccagccattcagagtctaccattgct
catgtggacaagaactggagtgcccaagaaagaccaaatagtgtccagataaaccaagca
tcacttcagagttttgaaaagactttgcaacctgaatcggatcaccatcaaaaccatgat
agaccagaaagctggaatggaaggaaaggaggaaagcagcactatggggaatccactgac
tttaacagtgggaagggatatggcttagcctgggactttaaccagtcagaacagcccagc
agcacatttcagcaaccggatagcagtcatggcactgatcacccacctcaaccaggaatt
gctctgtttgatagcggtcaaagacaaggtccatggactcagcctgccatctctaaaacc
aacagaccagtcaatgcacatgtgccttttcagtatcatgattcagttaaccagatccat
ccagactctttgaccaatgatcacgatgacgacagggtagtagggatcaaacaaggatct
atcctgtctgctgatcttccaggatcatccccatttgttcaagcccatgagataagcagc
aattgcagcttcaccacagaaagtcagaacatctcagaagcccctagagaagacaaccaa
aagcctcatcgaggaaggggtccacctaagaagagacgtcaagagtttgaatctgaatcg
gataatgaggcagaggctggtctgagcagtaaaagggtgtgtttggatgagagttcaagg
gttgtgaaagatggtaaggaatctttccaccaaattcaagaggtggcgcgcccactgctc
agtctcaaagaatttgtggatccagctgtttggagggaaaaggcaaagcagaaaaaaatg
ccaccctactttgacctcatcgaagaaaatttatatctgacagaacgcaagaagaataag
tctcatcgagacatcaagcgtatgcagtgtgagtgtgctatcctctcaagggaagagcgt
gcccgaggaatgatggcttgtggggaggattgcctcaatcgcttgctgatgattgagtgc
tcttctcggtgtttaaatggggcatactgctccaacaggcgctttcaaatgaagcagcat
gcagactttgaggtaattttgactgagagcaaaggctggggcttacgagcagccaaagat
ctacagccgaacacctttgttttagagtactgtggagaagttttggatcatcgggaattt
aaggcacgggtgaaggagtatgcacgaaacaagaacattcactattatttcatggctttg
aaaaataatgagattattgatgcgactttgaaaggaaactgttcccgtttcatgaatcac
agctgtgaacccaattgtgaaactcagaaatggactgtaaatggccagctccgagttggc
ttcttcaccaccaaagctgtgacggctgggacagaactcacttttgattatcagttccaa
agatacggtaaagaggcccagaagtgtttctgtggagctcctagctgtcgaggtttaatt
ggtggagagactcgggttagtgttcgagcagcaggtgggaagaaacagagggagcgctct
cggaagaaagacactgacagtgcacttaccacgttggatgaagagctggaggctctgcag
gagaatggagaaggcttgtgcggagagaaagatgtgatctcactctgcaggctcatggtg
cgagtggagacaatggagcagcgactcacctgccttaaactcattcagaatacccagaat
cccttgtgcctgaagcagtttttggatcaccacggcctctcgctgctgtggatatttatg
gttgaactttctgaggctaagagcaactctgtaaacaacattaaactacagctggagata
atgaaggctctggcagtgcttcccatctcaacaaagaatatgctggaggagagccgagtg
ctgcagtttatccagcgctgggctcaaagccggccactcagccaaccggcagaacaggat
ggctactccagtgagagcacctcacgtgcccagacgcccctaaacacccctgatggtcca
ccagccaagctggcttctgagttagatggggacactcccaagcgagcagtctaccgtagg
ttgaagatcatcagtgaaaacagtctggacagcgccatgtccgatgctagtaaagcttcg
gatgggaaagaagaggaggatgaggaagaggaagaaatggaggatgagacttcacagttg
gaagccacaattgaaagggaggttaaagtggagaacagtgaagcgccttctgagagtcat
gctgagcctgagcccgaattgaaacaggagccccctgaaaccgaagaagtcacacattca
accccagaggccactggcagtgagggagagccacttgaaacacaagaacctgaagaaaaa
cccatcatcaagcctgaagaacaactggaggatgaaaagatcgtggaggagaccaagagc
gaggagccatcagagtcccagacggagtcagcaacagttgaagatgcctctccagtcacg
gacaccacatctgcagcggacattagtaatgatgtagttgctgaagtggaaactcccatg
gctgagacacaggtggaaaacgcatcttctgaacaatgcagctccgaagggaatgaaagt
tgcagcactgcagaaatcacacccacacaaccatcggagactataatggagagcgtgtcc
tctgaatctacagctgttgccatagagagcgcacccacagaatctctgcctgcctctgag
gaaaccactccacctgaaactgctgctgtttctactgaaaacatatcatcagaggctgcc
gtagctgccggttctgctgatgcgccgaccctggctattgtggctgttccagcagagggc
gctgcggtggggacgccctctcaagatgaggaggaaggtgtttctgatgtggagagcgaa
cgcagtcaggagccacaagttcaggcttctgatatcagtgacatggccgcccggctgctg
gacagttggaaagacttaaaggaagtttacaggataccaaagaagagccaagttgaaaaa
gagtcaagtgatcgcagtcgtgatcgagaagccctgatgacccctcgcacaccttcgagc
agtcgagagagagagcgagaaagagagaaggagcgcgatcgggatcgagaccgggacaga
gacagagactgggagcgtgaacgggactgggaccgtgagcgggaccgggagagggatgga
gagagatcgtctcttcgcagtgcagatagaaaaagacgacgaggctccacttccccacta
ccaccttcagcctatgagaggggccgcagaaatgatgaccgcctacttaaatactcctac
ttaaatactgtaattctgtatatacactgtgtatatttttcgggatgttacaccacgctc
tgggaccccaacacacagcaagcggtcacggtgcagacgcagccaacccagcagtactcc
accacagcacagcctcagactgccatctactatcagggccagccctgccagaccatctat
agcattcctgcaggctacccacaaaccaacactcctgtcatacagacatacactgagcca
gctgccagttacctacatgggcagcaggtgtacacgggtcatcagcagggtgtggttgtg
cagcagggaggcacggtcaccaccatagtcacatctcagacagttcaacaggaaatgatc
gtacccaacagcatcattgatctaccgnccccttcccctcccaaacctaaaacaattatc
ctgcctcccagttggaaagtggcgcgagacccagagggcagaatctattactaccacatc
atcaccaggcaaacacagtgggatcctcccaactgggatgggactacagaggaagccagt
ctagaacatgaggctgagatggacctcgggacgcccacttatgatgaaaatccttcaaag
ttctctacaaagaccgccgaggcagacacgtccagtgagctggccaaaaaaagcaaagaa
gtcttccgcaaggagatgtcacagtttattgtgcaatgccttaatccgtaccgcaagcca
gactgcaagctgggccgtatcagtaacacggaagacttcaaacatctcgctagaaagctg
actcatggggtgatgaacaaggaactgaagtcttgcaagaaccccgaagaccttgaatgc
aacgagaacgtcaaacacaagaccaaggagtacatcaagaagtacatgcagaagtttggc
actgtgtaccggcccaaggaagacaccgagctggactaa

DBGET integrated database retrieval system