KEGG   Cyprinus carpio (common carp): 109063204Help
Entry
109063204         CDS       T05134                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00052  Galactose metabolism
ccar00500  Starch and sucrose metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109063204
   00500 Starch and sucrose metabolism
    109063204
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109063204
    3.2.1.20  alpha-glucosidase
     109063204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil
Motif
Other DBs
NCBI-GeneID: 109063204
NCBI-ProteinID: XP_018935837
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MVVLLATGEPGTMKEGSDPDIVPECPNIPEGERVDCFPDGSASQQKCLERGCCWSPLSET
NVPWCFFSKNHGYSVVSESKPDSTHIEAKLTRMDAPSLFGADIKELTFSAEMQTENRLRF
KITDANQARFEVPHEHVQSLSDTPRGPLKYRLELIQKPFGLKVWRTTSPEKLLFDTTVGP
LVFADQYLQLSAKLSSHNIYGLGEHVHQTFRHDTNWRTWPIFTRAAFPNGVKVTVQPAPA
VTFRTIGGVLDFYILVGETPETVVDEFTKLIGRPFIPPYWSLGFQLSRWDYGSLEEVKKV
VERNRQAGLPYDVQYTDIDYMENKKIFTYDMEKFAELPQFADYMHDKGQKYIVILDPAVS
TGQRINGPYEALERGHAAKAWVTEPDGVTSLLGEVWPGETVFPDYTNQACIDWWVDEISR
FHKEVKHDALWIDMNEVANFVKGGINGCTDNKLNYPPFTPSILDDLMYSKTLCMDAKHKW
GNHYDVHSLYGYSMVLATDKASKATFGTSRSMIFTRSSFPGVGKYSGHWLGDNGANWNDI
KWAIPGMLEFNLFGIPYSSINFVLDAS
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggtcgttctactggccactggggaaccagggacgatgaaagaaggatcagatccagac
atcgtcccagaatgtcccaacattccagagggagagagagtggactgtttcccagatggc
agcgcttctcagcaaaaatgtttggaaaggggttgctgttggagccccttgagtgagact
aacgtcccctggtgcttcttctccaaaaaccacggatacagcgtggtcagtgaaagcaag
ccagacagcacacatattgaggccaagctgacaagaatggatgccccatctctatttgga
gccgatattaaagagttgaccttctccgctgaaatgcagacagaaaaccgtcttcgattt
aagatcactgatgcaaatcaagccaggttcgaggttcctcatgagcatgtgcagtccctt
tccgacactcccagaggacccctaaaatatagattggagctgatccagaaaccctttggg
ctgaaagtttggagaacaacatctcctgaaaaactcttgtttgacacaaccgttgggccg
ctggtttttgctgatcagtatcttcagctctcagctaaactctcctctcacaatatttat
ggccttggagagcatgtccatcagaccttccgtcatgacaccaactggaggacctggcct
atcttcacaagagctgcttttcccaatggagtgaaagtgacagtccagcctgctccagcc
gtaaccttccggactatcggtggggttttggatttctacatcctggttggagaaacaccg
gaaacagtggtggacgagttcacgaaactgattggcaggcctttcatccctccgtactgg
tctctgggcttccagctctctcgctgggactatggcagcctggaggaggtgaagaaagtc
gtggagagaaatcgacaggccggccttccgtatgatgtccagtacactgatattgactac
atggagaacaaaaagatcttcacctatgatatggagaaatttgcagagctccctcagttt
gctgactacatgcatgataaagggcagaaatacatcgtcatactggatcctgctgtatcc
acaggtcaaaggataaacggaccctatgaagcacttgagaggggacatgcagctaaggct
tgggtcactgaaccagatggggtaacgtctttactgggagaggtctggccaggggaaacc
gtgtttcctgactacactaaccaggcttgcattgattggtgggttgatgaaatttcccgg
ttccacaaggaagtcaagcatgatgctctctggattgacatgaatgaggtggccaatttt
gtgaagggaggcatcaacggctgcactgataacaaactcaactatcctccattcacccca
agtatcctcgatgacctgatgtacagtaagaccttatgcatggatgctaaacacaaatgg
gggaaccactatgatgtccacagtctgtatgggtactctatggtcctggccactgacaag
gcatcaaaagcaacgtttgggacgagccgttccatgatcttcacccgctcctccttccct
ggggtgggcaaatactctgggcactggttgggagacaacggtgccaactggaatgacatt
aagtgggcgatacccggcatgctggagtttaacctctttggaatcccttattcaagtatc
aactttgttttagatgcttcttag

DBGET integrated database retrieval system