KEGG   Cyprinus carpio (common carp): 109064291Help
Entry
109064291         CDS       T05134                                 

Definition
(RefSeq) probable inactive glycosyltransferase 25 family member 3
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00310  Lysine degradation
ccar00514  Other types of O-glycan biosynthesis
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109064291
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    109064291
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccar01003]
    109064291
Enzymes [BR:ccar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     109064291
Glycosyltransferases [BR:ccar01003]
 O-Glycan biosynthesis
  O-linked Gal type
   109064291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 109064291
NCBI-ProteinID: XP_018936836
LinkDB All DBs
Position
Unknown
AA seq 591 aa AA seqDB search
MLSWITSVWTIFAVAQCYFPEENYTEDSKMQQPTVVIAIIARNAAHSLPYYLGALERLNY
PKERISIWVATDHNIDNTTAILQEWLTVMQTHYHYVEWSPLDNPISYVGELGPKHWTNGR
YEYVMKLKQAALNFAKKRWADYILYSDTDNILTNPETLNLLMAENKSVIAPMLDSQSAYS
NYWCGITPQGYYRRTAEYFPTKQRQRRGCYPVPMVHSTILLDLRKEGTKKVSFHPPHKDY
SWPFDDIIVFAFSCRIWEVQMYLCNKERYGYLNVPAKPHQTVEDDQINFVHLYLESLIHG
PPMYVSRYVHVPPKQSDLMGFDEIYLINLRRRPDRRDRMLWSLYELEIDAKVVDAVDGAA
LNSSDIKILGVDLLPGYYDPFSGRTLTKGEVGCFLSHYYIWKEMVDMQLDKVLIFEDDVH
FQTNFKRRLMRLMEELEQVELDWDIIYLGRKKVNPEEEVPVENVRNLVYADYSYWTLSYA
ISLQGAQKLLNAEPISKMLPVDEFLPIMYDKHPNEDYKSHFPNRNLMAYSTHPLLVQPCH
YAGDPEWVSDTETSTLWDDDNVRTDWRGSHKTLKGYQPPAGLQSATHKDEL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgttatcttggattacaagtgtttggaccatttttgcggtagcacaatgttactttcca
gaggaaaattataccgaagattcaaagatgcagcagcccacagtcgtaatagcaatcata
gcacggaacgccgctcattctttaccctactacctcggagctctcgagagattaaactat
cccaaagagcgcatctctatctgggtggcgacagaccacaacattgacaacacaacagca
atcctgcaagaatggctcacagtcatgcaaacacactatcactacgtggagtggagccct
ttagataaccccatatcctatgtaggtgagctggggcccaagcactggactaatggccgc
tatgagtatgtcatgaagctcaaacaggcagcgctgaactttgccaagaaacgctgggct
gactatattctgtattcagacacagacaacatcctgactaacccggagacactcaacctc
ttgatggcggagaataagtcagtcatcgcccctatgctggactcacagtcagcgtactcc
aactactggtgtggcatcactccacagggatactatcgtcgtactgctgagtacttcccc
acaaagcagcggcaaaggcggggctgctacccggtgccgatggtccactccactattctg
ctggacctgcgcaaagagggcaccaagaaagtgtcctttcacccccctcacaaagactac
tcctggccctttgatgacatcatcgtttttgccttctcctgcaggatatgggaggttcaa
atgtatctgtgcaacaaggagcgttacggatatctgaacgtacctgcaaaacctcatcag
accgtggaggatgatcaaatcaattttgtccacctttacctggaatctctgatccacggg
ccgccaatgtatgtgtctcgctatgtccacgttcctcccaaacagtctgatctcatgggc
tttgatgagatctacttgataaacctgcgcagacgtccagaccgcagggacaggatgtta
tggtcgctgtatgagctagagattgatgctaaagttgtggatgctgttgatggagcggct
ctgaacagcagcgatattaagattctaggtgtcgatctcttacctggttactatgaccct
ttctccggccgcacgctgaccaagggagaggtgggctgcttcctgagccactactacatc
tggaaagagatggtagacatgcagctagacaaggtgctgatttttgaggacgatgtgcat
ttccaaaccaactttaagcgtcgcctgatgcggctgatggaggagctggagcaggtggag
cttgactgggacatcatatacctgggcaggaagaaggtgaaccctgaagaggaagtccca
gtggagaatgtgaggaacctggtgtacgctgattactcctactggacgctctcttacgcc
atctctcttcagggagctcagaagctccttaatgctgaaccgatatccaagatgcttcct
gtggatgagtttctacccatcatgtatgacaagcaccccaatgaggattacaaatcccac
tttcccaatcggaatctgatggcgtattccacacacccccttctggtgcagccctgccat
tacgccggggacccagagtgggtgagcgacacagagacgtctacgctgtgggatgatgac
aatgtgcgcacagactggaggggctcgcataaaactctcaagggttatcagccaccggcc
ggcctgcagagcgccactcacaaggacgagttgtga

DBGET integrated database retrieval system