KEGG   Cyprinus carpio (common carp): 109067664
Entry
109067664         CDS       T05134                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109067664
   04068 FoxO signaling pathway
    109067664
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109067664
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 109067664
NCBI-ProteinID: XP_018940118
LinkDB
Position
Unknown
AA seq 183 aa
MSKVRVSNGSPTLERVDARQADHAKPQVCRNLFGSVDREEFDRDVKEQMLEMEKASKEKW
NYDFAKNEPLAPGDYDWQEVDSKEVPEFYVRPPHAKRDTSTGTVDHNGNHDYLLTTSAQG
DSDNAEHGSRSDCRTALTTPRKRPSTEDQDLPCQSKRANVQATEANCCPEPSSHAPSKSE
PKT
NT seq 552 nt   +upstreamnt  +downstreamnt
atgtcaaaagtgcgcgtctccaatggaagcccgacgctggagagggtggacgcgaggcag
gcggatcacgccaaaccgcaggtctgcagaaacctcttcggctccgtggatcgcgaagag
ttcgacagggacgtcaaggagcagatgctggagatggagaaagcgtccaaagaaaaatgg
aattacgacttcgccaaaaacgagccgctcgcgcctggcgactacgactggcaggaggtg
gactcgaaagaggtgccggagttttacgtcagaccgcctcacgcaaaacgggatacctcg
accgggactgtggatcataacgggaaccacgactatttgttgacaacgagcgcacagggg
gactctgacaacgcggagcacgggagtcgctcggattgccgaacggcgctgaccacgccg
agaaaaagaccgtcgacagaggatcaggatcttccttgccaaagcaaaagagccaacgtc
caagcgaccgaggcgaactgctgtccagagccgagttcgcacgcgcccagcaagtcggag
cccaaaacgtaa

DBGET integrated database retrieval system