KEGG   Cyprinus carpio (common carp): 109069551Help
Entry
109069551         CDS       T05134                                 

Definition
(RefSeq) glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00500  Starch and sucrose metabolism
ccar01100  Metabolic pathways
ccar04910  Insulin signaling pathway
Module
ccar_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109069551
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109069551
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ccar01003]
    109069551
Enzymes [BR:ccar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109069551
Glycosyltransferases [BR:ccar01003]
 Polysaccharide
  Storage polysaccharide
   109069551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4 Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 109069551
NCBI-ProteinID: XP_018941729
LinkDB All DBs
Position
Unknown
AA seq 632 aa AA seqDB search
MESSVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVILLDVGFTAWSLDR
WKSELWENCGIGVPWFDREANDAVLFGFLTAWLLGEFAAQCDEPPHIVAHFHEWLAGLGL
VLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYHRYCLERAA
VRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFV
RGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTVIAFFIM
PARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPDVSKMLDKEDFTMM
KRAIFATQRQCLPPVCSHNMLEDSSDPILNCIRRIGLFNTAQDRVKVIFHPEFLSSTSPL
LPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSAY
GIYILDRRFRGVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYLGRYYVSA
RHMALAKAFPDKFIYEPQEPTSATGFRYPRPASVPLSPAHSLHSSPHHSEAEDEEEPYDE
DLEAEKDRVNIRQPFNMPNRNKNQTVGLPEKN
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atggagtccagtgtcaggacgcaagtggagctgatcgaaccctgcaatgcggcactcagg
agaaccattgataaaatgaacagcagtgggtgcaaggtatattttggtcgatggctgatt
gaaggctctccgtatgtgattctgctagacgtgggcttcacggcctggtctctggaccgc
tggaagagtgaactctgggagaattgcggtattggtgtgccctggttcgacagagaggct
aacgatgctgttctctttggcttcctcactgcatggctacttggagagtttgcagctcag
tgtgacgaacctcctcacatcgtagcacattttcacgagtggctggcaggtttggggctc
gtcttatgcaggcagcgtcagttacccgtagcaaccatcttcaccacacatgccacactg
ctcggccgatacctgtgtgctgggaacgttgacttctacaacaaccttgctgagtttaat
gtggataaagaggcaggtgacaggcagatctatcaccggtactgtctggagcgcgcagca
gtgcgctgtgcacacgtcttcaccaccgtctctcagatcaccgccattgaggccgagcac
ttactaaagcggaaaccagatattgtgactccaaacggcctgaatgtgaagaagttctca
gccatgcacgagttccagaacctccacgctcagagtaaagcgcgcatccaggagtttgtc
agaggccatttctacgggcatttagattttaaccttgacaagacagtgtttctcttcatt
gctggacgctatgaattctcaaataaaggagctgatatctttcttgaagcactggccaga
cttaattacctgctgagggtgaatcacagtgatgtgaccgtaatcgcgttcttcatcatg
cctgctcgtaccaacaacttcaacgtggagaccctgaagggccaagccgtacggaaacag
ctctgggacactgctcagactgtgaaggagcgctttgggaagaaactctacgaatcactt
ttagtagggcagctgcctgatgtgtctaagatgttagataaagaggacttcaccatgatg
aaacgtgccatcttcgccacccagcgccagtgcctgccccccgtctgcagtcacaacatg
ctggaggacagcagtgaccccatcctcaactgcatccgccgtatcggcctctttaatact
gctcaggacagagtcaaggtgatcttccatccagagtttctctcctccacttctcctctc
ctgccgatggactacgaggagtttgtgagaggctgccatcttggagtatttccatcctac
tatgagccctggggatacacaccagctgagtgtacagtgatgggtatcccgtcggtctcc
actaacctgtctgggtttggctgtttcatggaggagcacattgctgacccgtcagcttat
ggtatctatattctggatcggcggttccgtggggtggatgagtcctgcaatcagctgaca
tctttcctgtttcaattctgtcagcagagccgcaggcagaggatcattcagaggaaccga
acagagcgcctcagcgacctgttagattggagatatttgggcaggtattacgtatctgcc
cgccatatggctttagcgaaagctttcccagacaaattcatctatgagcctcaagaaccc
acttcggccacaggcttccgttacccgcggcccgcctcagtgcccctgtctccagcccac
tcgctgcactcgtctcctcatcacagtgaggctgaggatgaagaggaaccatatgatgaa
gatctggaggcggagaaagaccgggtcaacatccgccaacctttcaacatgccgaaccgg
aacaagaatcagacagttggtcttcctgagaaaaactaa

DBGET integrated database retrieval system