KEGG   Cyprinus carpio (common carp): 109071632Help
Entry
109071632         CDS       T05134                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00590  Arachidonic acid metabolism
ccar01100  Metabolic pathways
ccar04370  VEGF signaling pathway
ccar04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109071632 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109071632 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109071632 (ptgs2)
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109071632 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 109071632
NCBI-ProteinID: XP_018943611
LinkDB All DBs
Position
Unknown
AA seq 601 aa AA seqDB search
MNRLICLVLLSSFWIFPGEGYDPCCAQPCQNQGVCLSKGADAYECDCTRTGYYGENCTTP
EFLTLVKSTLKPRPSIVHHILTHYEWIWDIINSISFLRDAIMRYILTSRSHLVNSPPTYN
ADYNYKSWEAYSNLSYYTRTLAPLPQNCPTPDLPNAKEVVEKVLVRKQFIPDPQRSSLMF
AFFAQHFSHQFFKSDFKKGPAFTKALGHGVNLGHIYGETLERQHKLRLFKDGKLKYQVVD
GEVYPPLVKDVQVDMHYPPHIPEEQRFAVGHEAFGLVPGLMMYASIWLREHNRVCDIMKQ
EHPDWDDERIFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFSERFQYQNRIA
SEFNTLYHWHPLMPDNFQIQDQVYGHHQFVFNNSILTKHGIRNMVESFTKQKSGRVAGGR
NLPATVQGVAINVLEHSRQMRYQSFNAYRKRFNMKPYSSFEEMTGDKELAAEMKQLYGHI
DAVELYPGLLVEKPRPNAVFGETMVEMGAPYSLKGLMGNAICSPEYWMPSTFGGKVGFDI
VNSASLKKLVCLNINGPCPMVSFQVPDVKHQSSENGNSSSVHSTQNNINPTVLLNERSSE
L
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaatagactgatctgcctggtcttactttctagcttctggatctttcccggtgaagga
tacgacccatgctgtgcacagccctgccaaaaccagggtgtgtgtttatctaagggagct
gatgcttatgaatgtgactgtaccaggacaggatattatggggaaaactgcactacccct
gaatttctcacacttgtcaaatcaactctgaaaccaaggccaagcatagtgcatcatatt
ttaacgcattatgaatggatctgggacatcatcaacagcatctctttcctgagagatgct
ataatgagatatatcctgacatcaaggtctcatttggtcaacagtccaccgacgtacaat
gcagattataactacaaaagctgggaagcgtattctaacttgtcctattacacccgcacc
ctcgccccattgccccagaactgccctacgcctgatctcccaaatgcaaaggaggtggtg
gagaaggtgctggtgaggaaacagttcatccctgatccacagaggagcagtctcatgttt
gctttcttcgcccagcatttctctcaccagttcttcaagtcagactttaaaaaaggacca
gccttcaccaaagcactgggccatggagtgaatttggggcatatttatggagagacgctg
gagagacaacacaaacttcgtctatttaaagatggaaagctgaagtatcaggttgtggat
ggtgaggtgtatcctccgctggtgaaggatgtccaggtggacatgcactatcctcctcat
atcccagaagaacagagattcgctgtgggccatgaggccttcggtctggttccaggattg
atgatgtatgctagcatttggcttcgtgagcacaaccgtgtctgtgatatcatgaagcag
gagcatcccgactgggacgacgagaggatcttccaaaccacgcgtctcatcctgattggt
gagaccatcaaaatcgtgatcgaggactacgttcagcacttgagcggctaccacttcaag
ctcaagtttgacccagagcttctcttcagtgagcgctttcagtaccagaaccgcatcgcg
tccgaattcaacactctgtatcactggcaccctctgatgcctgacaactttcagatccag
gaccaggtctacggccaccaccagtttgtgtttaacaactcgattttaaccaaacacggc
atccgcaacatggtggagtccttcaccaaacagaagtctggaagggttgctggtggacgt
aacctgcctgctacagttcaaggagtggctattaatgttctggagcattccagacagatg
cggtaccagtctttcaatgcctacaggaaacgcttcaacatgaagccctactcctctttt
gaggagatgacaggagacaaggagctggcagccgaaatgaagcagctgtacggtcacata
gacgcggttgagctgtatcctggccttcttgtggagaaacccagacccaacgctgtgttt
ggggagactatggtagagatgggagccccctactctctcaaaggcctcatgggaaatgct
atttgttctcctgaatactggatgccgagcacatttggtgggaaagtgggatttgacatt
gttaactcagcgtcactgaagaagctggtgtgcttgaatatcaacgggccctgtccaatg
gtgtcctttcaggtgcctgatgtgaaacatcagagttcagaaaacgggaattcaagctca
gtgcactctacacaaaataatattaatccaacggttttattgaacgagcgaagttcagag
ctctaa

DBGET integrated database retrieval system