KEGG   Cyprinus carpio (common carp): 109071661Help
Entry
109071661         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neutral alpha-glucosidase C-like
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00052  Galactose metabolism
ccar00500  Starch and sucrose metabolism
ccar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109071661
   00500 Starch and sucrose metabolism
    109071661
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109071661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109071661
NCBI-ProteinID: XP_018943632
LinkDB All DBs
Position
Unknown
AA seq 684 aa AA seqDB search
MEVNVSAESFESLVPGGELQEKFKKNHDIIFYRRQRDKAASQYFASFETLLLTDRGASLE
LCERDSQDRLCLQIRATQSGTVRVSLDELQPVKPRYHVSDVLLGELRYEPLRVNWKREDC
VCLTWGLGQYKLLVSFSPFKLEISCDGEEIVTLNPENKLYFETLQDPTRSSSDSCQDDAN
RCGLWKETFRQFEDIKANGPSSVGMDLSLHGFKHTYGLPEHADTLVLKDTSVTEAYRLYN
LDVFGYDINSRLGLYGSVPFLLAHKLERTAGVFWLNASETLVDVKYNPEPNEGEDEPPGK
KSKISPQTDVRWISESGTVDCFILLGPTAAQVFSQYAQLTGYQALPPLFSLGYHQCRWNY
EDEADVKAVDAGFDLHGIPYDVIWLDIEHTNGKRYFTWDSQLFPNPAELQHHLQKKNRKL
VVISDPHIKIDPDWPLYCEAKEGGHFVKNREGVVYEGTCWPGESCYLDFSSSKTRSWYAR
QFSLSKYEVSGALLVCPVTDPGVTEVKVLLPGSDELWYDTNTAAVHNGARTLDLPVTLNT
VPVFQRGGTVVPRREGCGSSTADLQQHPITLTVALDSKGNADGFLYLDDGHSFSYRDQMQ
FCLRRFTMRAGRLVNSCANDQGSFDSDDKVESVVILGLNSLKRKPKLKPGAPKTTVTFEF
DAKRGVLTLTGLDLEIRKDWEIVI
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaatgtttcagctgaatcttttgagagtctcgtgccgggtggtgagcttcaa
gagaagtttaagaaaaaccatgacataatattctacaggagacagagagataaagcagcg
tctcagtactttgcctccttcgaaactttattgctcacagatagaggagccagtctggag
ctctgtgaacgggactctcaggatcggctgtgtcttcaaatacgggcaactcaaagtgga
acggtccgagtgtctcttgatgagctacagccggtgaaaccacgctaccatgtttcagat
gtactgcttggagagttgagatatgagccgctgagagttaattggaagagagaggactgt
gtttgtctaacttggggtttgggacagtacaagctgctggtttccttttctcctttcaaa
ctagagatttcctgtgatggagaggagattgtcactctcaacccagaaaacaaactctac
tttgagactctgcaagatcccaccaggtcatcttcagattcatgccaggatgatgcaaat
cgatgtgggctgtggaaggaaacattcagacagtttgaggacatcaaagcaaatggtcct
agttctgtggggatggacttaagtcttcatgggttcaagcatacgtatggtcttcctgaa
catgctgatacactggtgttgaaggacacaagtgtcacggaggcgtatcggctgtacaac
cttgatgtgtttggctatgacatcaatagcaggttgggtctttatggatctgtccccttc
ctgctagctcacaagctggagaggacagctggagtgttctggctgaacgcctctgagact
ctggttgatgtcaagtacaacccagagccaaatgagggtgaggatgaacccccagggaag
aaaagcaagatctcaccacagactgatgtgagatggatatcagagagcggcacagtcgac
tgtttcattttgctgggacccacagctgcccaggtgttctctcagtatgctcaactcaca
ggctaccaggctctacctccactcttctctttgggttatcaccaatgccgctggaactac
gaggacgaggcagatgtgaaagcggtggatgctggatttgacctccacggtattccgtat
gatgttatatggttggacatagagcacacaaatgggaagcgctacttcacctgggattcc
cagctttttccaaacccagcagaactacagcatcaccttcagaagaagaacaggaagttg
gtcgttattagtgatccgcacatcaagattgatcctgattggccactttactgtgaagct
aaagaagggggtcatttcgtgaagaatagagaaggtgttgtttatgaaggaacatgctgg
cccggtgaatcctgttatttggacttcagtagctcaaagacaaggtcatggtatgccaga
cagttctctctaagcaaatatgaagtgagcggtgctctccttgtgtgccctgtgaccgat
cctggggtcacagaggtcaaggttttgctcccagggtctgatgagctgtggtacgacaca
aacacggcagcggtacacaatggtgccagaactctggatctgccagtgactctgaacact
gtgcctgtgttccagcgaggggggacagtggtgcccaggagagaaggttgtgggtccagc
acagcagacttacagcagcatcccatcactctcactgtggccctggacagtaagggcaat
gctgatggatttctttatctggacgatggccactcttttagttacagagaccagatgcag
ttctgtctgcggcgttttaccatgcgagctggcaggcttgtcaacagctgtgctaatgat
caaggctcgtttgactcggatgacaaagtggaatcagtggtcattcttggtctgaatagc
ttgaaaagaaaacccaagctcaaaccaggtgcgccgaagacaacagtcacgtttgaattt
gatgcaaagcgaggtgtgttaactttaactggactggacctagaaatacgcaaagactgg
gaaatagtaatttag

DBGET integrated database retrieval system