KEGG   Cyprinus carpio (common carp): 109072229
Entry
109072229         CDS       T05134                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109072229
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    109072229
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ccar04052]
    109072229
Cytokines and growth factors [BR:ccar04052]
 Growth factors
  Growth factors (RTK binding)
   109072229
SSDB
Motif
Pfam: SCF TMEM154 DUF3439 Podoplanin
Other DBs
NCBI-GeneID: 109072229
NCBI-ProteinID: XP_018944035
LinkDB
Position
Unknown
AA seq 316 aa
MAAVEEFDILDSEHLRLNSLSSDESALHLCSAPPLFQPLARFSRQGSCIIWICTCVHLLL
YMTVAAYSSEIGNPITDDIKKISLLKQNIPKDYKITLRYIPKEVSGMCWVKLNVFHLEVS
LKGLAQKFGNISSNKDNIGTFVQILQEMRYHIGHGLEDSMLEFDCHYENEMWLTAKYFEF
VEDFFNTANSSKDAEDCEPPPCPTSTKTTVTTTTTALTTSAQHSTNEKHNGLPDDPEKGA
FLPKVVQSSLMSLLAIPFIAVVVFLLVWKMKSRRNAPQTERSPEEGPALFSGEEANIPPL
DVEISEKNRLNIIMAV
NT seq 951 nt   +upstreamnt  +downstreamnt
atggctgccgtggaagaatttgacattcttgactcagagcatctccggctaaacagcctg
tcctcagatgagtctgctcttcacctctgctccgctccccctctctttcaaccgctagcc
cgtttctcccgacaaggctcatgcattatttggatatgcacctgtgtccatttattgctg
tacatgacagttgctgcctattccagtgaaataggaaatcccattacagatgacatcaag
aaaatttctttgttgaaacagaatattccaaaagactacaagattacattacgttatata
ccaaaagaagtgagtggcatgtgctgggtgaagctaaatgtatttcacttggaggtgagc
ttaaagggcctggcgcagaagtttgggaacatatcctccaataaagataatataggcact
tttgttcaaatactgcaagagatgcggtatcacattggacatggcttggaggattcaatg
ctagaattcgattgtcactacgaaaatgagatgtggcttacggcaaagtattttgaattt
gtggaggactttttcaatactgctaattcatcgaaagatgctgaggattgcgagcccccg
ccatgtcccacatctacaaaaacaacagttacgacaactaccacagcgttgacaacatca
gcgcaacatagtacaaatgagaaacataacggtttgcctgatgaccccgaaaaaggggca
ttccttccgaaagttgtgcagagcagtctcatgtcgctgctcgccatcccgttcatcgca
gtggtggtgtttctgttggtctggaagatgaaatctagaagaaatgccccacaaactgaa
cggagtccagaagaaggtcccgcccttttctcaggagaggaagccaatatacccccatta
gatgtggagatatctgaaaaaaacagattaaatattatcatggcagtgtaa

DBGET integrated database retrieval system