KEGG   Cyprinus carpio (common carp): 109074034Help
Entry
109074034         CDS       T05134                                 

Definition
(RefSeq) neuroendocrine convertase 1-like isoform X1
  KO
K01359  proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
ccar  Cyprinus carpio (common carp)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ccar01002]
    109074034
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ccar03110]
    109074034
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     109074034
Peptidases [BR:ccar01002]
 Serine Peptidases
  Family S8: subtilisin family
   109074034
Chaperones and folding catalysts [BR:ccar03110]
 Intramolecular chaperones
  Subtilisin family
   109074034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 P_proprotein S8_pro-domain Proho_convert Peptidase_S8_N
Motif
Other DBs
NCBI-GeneID: 109074034
NCBI-ProteinID: XP_018945635
LinkDB All DBs
Position
8
AA seq 768 aa AA seqDB search
MEKRCRPMLLCSVLALFCALVSSAVDRQYLNEWAVEIPGGYDNARSIADELGYKLVRQIG
ALENHYLFKRHSHPSRTKRSADHITKRLSEDDRVSWAEQQYEKRRAKRAPLGTECKDCSV
DKLFDDPMWNQQWYLQDTRMSSSLPKLDLHVIPVWKKGITGKGVVITVLDDGLEWNHTDI
YPNYDPAASYDFNDNDPDPFPRYDSTNENKHGTRCAGEIAMQADNNKCGVGVAYNSKVGG
IRMLDGIVTDAIEASSIGFNPDHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGIQKGRG
GKGSIFVWASGNGGRQGDNCDCDGYTDSLYTISISSASQQGLSPWYAEKCSSTLATAYSS
GDYTDQRITSADLHNECTETHTGTSASAPLAAGIFALALEQNPDLTWRDLQHLVVWTSEF
DPLANNPGWKRNGAGLMVNSRFGFGLLNAKALVDLADPKVWKHIPEKKQCIVRDETFQPR
PLKAAGEISIEIPTKACAGQANSVVSLEHVQVEVSIEYTRRGDLHITLTSPSGTTTVLLA
ERERDTSSNGFRNWAFMSVHTWGENPTGTWTLKITDTSGRMENEGQIISWKLILHGTSEK
PEHMKEARVYTPYNAVQNDRRGVEPMEDMIKQEAPTPAHKPEISSPVVPDLLPSAASISV
PEKNPEAPGSSTASLALLRLLQSAFNRQTPAVPQHALAVPPAPPKSFQPERIPPQKLYQA
LDQLNHYRGSENGLFSDYSDNFYRAQPYRHRDDRLLQALFDMLGDDQQ
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaagatgtcgtccaatgttgctgtgcagtgttcttgctcttttctgtgcgctg
gtgtcctcagctgtggacagacagtatctgaacgaatgggcggtggagattccaggagga
tacgacaatgcccgatccatcgccgacgagctcggatacaaattagtccggcagattggg
gcactggaaaaccattatttattcaagcggcacagtcaccctagcaggaccaaaagaagt
gcggatcatatcaccaaacgtctgtcggaagatgacagggtctcttgggctgaacagcag
tatgagaaacggagggccaaacgtgccccgctggggaccgaatgtaaggactgctctgtg
gacaaactcttcgatgaccctatgtggaaccaacagtggtatctgcaagacacccggatg
tcatcatccctgcccaaactggacctgcacgtgatcccggtctggaagaagggcattacc
ggcaaaggagtggtcattaccgtgctggatgatggcctcgagtggaaccacaccgacatt
tatcctaactatgatcctgctgctagctatgattttaatgacaacgatccagatcccttt
cccagatacgactccaccaatgaaaacaagcatggtaccagatgtgctggagagattgcc
atgcaagcagacaacaacaaatgtggtgtcggagtggcctacaactccaaagtgggaggg
atacgaatgctggatggaatcgtgacagatgccattgaagccagttccattggctttaac
cctgatcatgtggacatctacagcgccagctggggccctaacgatgacgggaagaccgtg
gaggggcctgggcgcctggcccagaaagcttttgagtatggtatccagaagggtcgtgga
gggaagggctccatttttgtctgggcgtctggtaacggtggtcgtcagggcgacaactgc
gattgtgatggatacacagacagtctgtacaccatctccatcagcagtgcatcccagcag
ggtttgtctccctggtacgctgagaaatgctcctctacgctggctacggcctacagcagt
ggagactacaccgaccagagaattactagtgccgatttgcacaatgaatgcacagagaca
cacactggcacatctgcatctgctccattggctgctgggatatttgcactggctttggag
cagaatcctgatctgacctggcgagaccttcagcacttagtggtttggacgtctgagttt
gaccccctggccaataacccaggctggaaaaggaatggagctggtttgatggtcaacagt
cgttttgggtttggtctcctgaatgccaaagctctagtggatctggctgatcccaaagtc
tggaagcacattccggagaagaaacagtgcatcgtcagagatgagacgttccaaccaaga
ccattgaaggctgcgggtgagatatccattgagatccccactaaggcctgtgcaggacag
gcgaattctgttgtatctctggagcatgtgcaggtggaggtcagcattgagtacacacgc
agaggagacctgcacatcacgctgacgtctccatcaggtaccaccacagtcctgctggcg
gagagagagagggacacatcatccaacggtttccgaaactgggcctttatgtctgtgcat
acctggggagaaaaccccaccggcacctggaccctgaagattacagatacgtctggacgg
atggagaatgagggtcagattatcagctggaagttgattttgcacgggacgtctgagaag
ccagagcacatgaaggaggcgagggtttacacgccctacaatgctgtccaaaacgatcgc
agaggagtggaaccgatggaagacatgatcaagcaggaagctccgactccagctcacaaa
cctgaaatttcaagtccagtggtcccagacttactcccgtctgctgcttccatcagcgtc
cctgaaaaaaatccagaagctccaggctcatccactgccagtctggccctgctgcgtctc
ctccagtcggccttcaacaggcaaaccccggcggttcctcagcacgctctggcggttcct
ccggctcctcccaagagctttcagcccgagaggatccccccgcagaagctgtaccaggcc
ctcgaccagctaaaccactacaggggctccgagaacggcctgttcagtgactacagcgac
aacttctacagagcccaaccgtacagacacagagacgaccggctgctgcaggcactgttt
gacatgctcggagatgaccagcagtga

DBGET integrated database retrieval system