Cyprinus carpio (common carp): 109075521 Help Entry 109075521         CDS       T05134                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ccar  Cyprinus carpio (common carp) Pathway ccar00860   Porphyrin metabolism ccar04216   Ferroptosis ccar04217   Necroptosis Brite KEGG Orthology (KO) [BR:ccar00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     109075521  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     109075521    04217 Necroptosis     109075521  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ccar04147]     109075521 Enzymes [BR:ccar01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      109075521 Exosome [BR:ccar04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    109075521   Exosomal proteins of bladder cancer cells    109075521 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  109075521 NCBI-ProteinID:  XP_018946962 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MDSQIRQNYDRDCEALINKMINLELYASYIYTSMSVWDNGLIAMQCALQLEKNVNQALLD LHKVASEKGDPHLCDFLETHYLNEQVETIKKLGDHITNLSKMDAGNNRMAEYLFDKQTLD GDSS NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggattctcagattcgccagaactacgaccgcgactgcgaggctttgatcaacaagatg atcaacttggagctttacgcttcttacatttacacttcaatgagtgtgtgggacaatgga ctgattgctatgcagtgcgctcttcagctggagaagaacgtcaaccaggctctgctggat ctgcataaggtcgcctctgagaagggagaccctcatctgtgtgacttcctggagactcac tacctgaatgagcaggttgagaccatcaagaaacttggtgaccacatcaccaacctttcc aagatggatgctggcaacaacaggatggcggagtacctgtttgacaagcagaccctggat ggagacagcagctaa

DBGET integrated database retrieval system