KEGG   Cyprinus carpio (common carp): 109076240
Entry
109076240         CDS       T05134                                 

Definition
(RefSeq) tomoregulin-1-like
  KO
K08774  transforming growth factor, alpha
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04010  MAPK signaling pathway
ccar04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109076240
   04012 ErbB signaling pathway
    109076240
SSDB
Motif
Pfam: EGF Laminin_EGF EGF_2 hEGF
Other DBs
NCBI-GeneID: 109076240
NCBI-ProteinID: XP_018947527
LinkDB
Position
Unknown
AA seq 186 aa
MYRAFWDTIFLLTEFIAAAVHSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHPGFVGM
RCEHADLLAVVASNHRQQTVATMLVLCVVGSVLLMLLCTLLNGLTCVFWSSRRCSLKNVT
TKSSILLLDFTMTAFLRLAQLVSAACIESISMWAVGELNQTWNFTFRQTVSFQKGYFWNN
NSNGKS
NT seq 561 nt   +upstreamnt  +downstreamnt
atgtatcgtgctttttgggatacaatattccttctcaccgaatttatagcagccgctgtc
cactctcacttcgatgactgcccggactcccatagccacttctgttttcatggcacatgc
cgctttctcatactggaggaaacacctgcatgtgtatgtcatcctggctttgtgggtatg
cgatgcgaacatgcagatctcttggctgtggtggcgtctaaccacaggcagcagaccgtg
gccaccatgctggtgttgtgtgtggtgggcagtgttctactcatgctgctctgcacttta
ctaaatggtttgacctgcgttttctggagctcacgcaggtgctctcttaaaaatgtgacc
acaaaatcttccatcttactcctggacttcactatgactgcgtttctcagactggcacag
ctggtaagcgcagcatgtattgagagtatttcgatgtgggcagtgggagaactcaatcaa
acatggaactttacattcagacagactgtgtcattccaaaaaggatatttttggaacaac
aacagcaatggcaagagttaa

DBGET integrated database retrieval system