KEGG   Cyprinus carpio (common carp): 109077732Help
Entry
109077732         CDS       T05134                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00052  Galactose metabolism
ccar00500  Starch and sucrose metabolism
ccar01100  Metabolic pathways
ccar04142  Lysosome
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109077732
   00500 Starch and sucrose metabolism
    109077732
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109077732
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ccar04147]
    109077732
Enzymes [BR:ccar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109077732
Exosome [BR:ccar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109077732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 GHL15
Motif
Other DBs
NCBI-GeneID: 109077732
NCBI-ProteinID: XP_018948740
LinkDB All DBs
Position
1
AA seq 959 aa AA seqDB search
MVSYKRLTPEEVHFSGAALLDPDESTDTDLKEEHPELPLLPQSPRCSITIALLTIGGLIV
VLSGVWLLGTIFWLHKPPSTEPHRPPLPAVARSPNGTWLQPEYCSQIPEAWRFDCYPERG
VVVTEEMCHARNCCFIQHSQAKTSGRNGVPWCFYTPDYPSYELVSIADTEIGKVGKLLRN
KKRNYPKDIDELQLEVLYEEDNRLHVKITDPAEKRYEVPIDVPVVQKRASSNPSYTVDFI
KEPFGLIVKRTQTGTVLLNTSIAPLFYADQFLQMSTSLPSRFIYGLGEHRSNFLHDVQWN
TLTMWARDVPPMELTNLYGVHPFYLSMESDGMAHGFFMLNSNAMDVALQPAPALTWRMIG
GILDFYIFLGPDPSSVIAQYLDVVGRPAMPIYWALGYHLCRWGYKSSDKTWNVVKEMRNY
GIPQDVQWNDIDYMDHALDFTYDTTNFSSLPDLVKDLHRHDQHYVMILDPGISNSQPSGS
YWPFDEGKKRGIFINDSNGASYGKVWPGLTAFPDFSNPDTHEWWYQNLKSFHEKVPFDGV
WIDMNEPSNFFDGSLNGCPENELENPPYTPGILGGTLKAKTVCASARQKISTHYNIHSLY
GLMEAKATESALRKITDKRPFVISRSTFPSQGKYSGHWLGDNRSQWKDLATSIPGMLTFN
ILGIPLIGADICGFGGSTTEELCVRWTQLGAFYPFSRNHNSIDEQDQEPTAFSPAARIAM
KEVILLRYSLFPHLYTLFHHAHISGQTVATPLLFQFPNDEKTYGIDKQFLWGKSLLVTPV
LEAGQDHVVGYFPKGLWYDFHTGDSLVSSGEEINLQAPIDKINLHLREGSIIPTQRPNTT
LWVSSGQPLNLIVSLSEDGLAKGDLYWDDGETIDTYEKDQYAYIYFTVEQNTMTSEVLHN
HEEAAYITVETVSFYGVKVEPENVTVNSQEAAFTYRDNQVLTVTDLGLNLSRNFTINWM
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgtacaagagactcacccctgaggaagttcatttctcaggagccgcattattg
gatcctgatgagtcgacggacacggatctgaaggaagaacacccagaactgcccctgctg
ccccagagccctcgctgctccatcaccattgccctgctgaccattgggggacttattgtg
gttctctctggtgtctggctgcttggaactatattttggttacataagccaccctccaca
gaacctcatagaccccctcttcccgctgtggctagaagcccaaacgggacgtggctgcag
ccggagtactgctcgcagattccagaagcttggaggtttgactgttatccagagagaggt
gtggtggtgacagaggagatgtgccatgctcgaaactgctgcttcatacagcactcacag
gctaagacatcaggacggaatggagtgccctggtgtttctacacacctgactatccatcc
tacgagttggtgtccattgctgacactgagattgggaaggtgggaaaactgcttcggaac
aaaaaacgtaattatcctaaagacatagatgaactgcagctggaggtgctgtatgaggag
gacaacagactgcatgtgaagataacagacccggctgaaaagaggtacgaggtgcctata
gatgttcctgtggttcagaaaagagcatcatcaaacccctcttacactgtagacttcatc
aaagaaccctttgggctgattgtcaagagaacacaaacaggaactgtactgctgaataca
tccatagctcctctcttctacgcggatcagtttctgcagatgtccacatcattaccatct
cgtttcatatatggactgggtgaacatcgctccaactttctgcatgacgtccagtggaac
actctcaccatgtgggctcgagatgtcccacccatggagctgaccaacctctatggcgtc
catcccttttatctttccatggaatctgatggaatggcacatgggtttttcatgctcaac
agcaatgcaatggatgtggctctgcagcctgctcctgctctcacctggcgtatgattggt
gggatccttgacttttacattttcctaggcccggatcccagctctgtgattgcacagtac
ttggatgttgtagggaggcctgcaatgcccatctactgggctctgggctatcatctctgc
cgatggggctacaagtcaagtgacaaaacctggaatgttgtaaaagaaatgcgtaattat
gggatacctcaggatgttcagtggaatgacattgactacatggatcatgctttagatttt
acttatgacactacgaacttttccagccttcctgaccttgtgaaagaccttcatagacat
gatcaacactacgttatgatcctggatcccggaatcagtaactctcagccgtctggctcc
tactggccatttgatgaggggaagaagaggggcatcttcatcaatgattcgaatggagca
tcctatgggaaggtctggccaggactcacagcctttccagatttctccaatccagacaca
catgaatggtggtaccagaatctgaagagtttccatgaaaaagtgccttttgatggcgtg
tggattgacatgaatgaaccatctaatttttttgatggatcactgaatggctgtcctgag
aatgaactggaaaatcctccctacaccccagggattctgggtgggacattaaaggccaag
actgtgtgcgcatctgcacgtcagaaaatctccactcattacaacatacacagtctgtat
ggactcatggaagctaaggcaactgaaagtgctttgaggaagatcacagataagcgtccc
ttcgtcatttcccgctctacgtttcccagtcagggcaagtattcaggccactggcttgga
gacaacaggagccaatggaaagacctggccacatccataccaggtatgctgacatttaac
atcctgggcattcctcttattggggcagacatctgtggctttggaggcagcactacagaa
gaactgtgtgtccgatggacccagcttggagctttctaccctttttcaagaaatcacaac
tccatagatgaacaggaccaggaaccaactgcatttagtcctgcagctcgaatagcaatg
aaagaagtcatcctcctgcgttattccctgttcccacatctctacacactcttccatcat
gcacacatcagtggacagacagtcgccacaccactgctcttccagttcccaaatgatgag
aagacatacgggatagataaacagttcctatggggaaagagtttgctggtcacaccggtt
ttggaggcagggcaagatcatgttgtaggatatttccctaaaggtctctggtatgatttc
cacaccggtgactcattggtaagcagtggagaagaaatcaatcttcaggctccaatagac
aaaatcaacctacatctcagagagggttccatcatacctacacagagacctaacaccacc
ctgtgggtgagcagcggtcagccccttaatctgattgtgagtctgagtgaggacggcctg
gccaagggtgatttgtattgggatgatggagagaccattgacacttatgagaaagatcaa
tatgcttacatctatttcacagtagaacagaatacgatgacatcagaggtgctgcataat
catgaagaggctgcttacatcacagtggagaccgtttccttttatggggtgaaggtggag
ccagaaaacgtaaccgtgaattcacaagaggcagcgttcacttaccgtgacaatcaggtg
ctgacagtaacagacttgggtctgaacctcagtcgtaacttcacaatcaattggatgtaa

DBGET integrated database retrieval system