KEGG   Cyprinus carpio (common carp): 109080897
Entry
109080897         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00220  Arginine biosynthesis
ccar00330  Arginine and proline metabolism
ccar01100  Metabolic pathways
ccar04020  Calcium signaling pathway
ccar04146  Peroxisome
ccar04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    109080897
   00330 Arginine and proline metabolism
    109080897
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109080897
   04020 Calcium signaling pathway
    109080897
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109080897
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     109080897
SSDB
Motif
Pfam: NO_synthase Flavodoxin_1 FAD_binding_1 NAD_binding_1
Other DBs
NCBI-GeneID: 109080897
NCBI-ProteinID: XP_018951450
LinkDB
Position
9
AA seq 602 aa
SDRVTLEITLTGSYTLTTDELTFGAKYAWRNAPRCIGRIQWANLQLFDARQCKTAKDMFH
ALCTHIYYATNGGNLRSTITVFPKRTDGEHDFRVWNSQLIKYAGYQMEDGSVIGDPSSVE
FTQHLETEVRLRGGCPADWVWLVPPMSGSLTPVYHQEMLNYILSPFFYYQADAWLTHKWK
DEKKGLRRCKVSFKGLIRAVFFSQMLIKAVMAKRVCCTVTLATETGKSLTFAKKLNTTSL
NRAFDSKLVCMEDYDFSELETESLLMVVTSTFGNGESPGNGVSFKKQLFSLQNLKNTVRY
SVFGLGSRVYPQFCAFAHAVDDKLAELGAKRLTATGEGDELNGQDEAFSAWACTAFKDAC
EEFNIKKQLKAVEQQSDDWDPQRYRVQHNSCTLDRVTALSALHSKTVFPMTLKRRQKLQC
AQSSRSTILVELKTDGNTEALNFAPGDHVGIFPENSQELVDGILKHLPDAPPVNQSFHLE
SLSDSSHVCQNPVPSSQSILFIKCIYTGISWCLQSVTVSLCCLEQMYVQDVLREQLSEKA
VEVLHKNAGHLYVCGGMNMARDVACTLQDILASKTGMAIAEAGEYLERMKVEKRYHEDIF
GA
NT seq 1809 nt   +upstreamnt  +downstreamnt
agcgacagggtcacactggagatcaccctgactggctcctacacactcactacagatgag
ctcacttttggggccaaatatgcttggagaaacgcgccgaggtgcattggcaggatccag
tgggccaatttacagcttttcgatgcgcgtcagtgcaagaccgccaaggacatgtttcat
gccttgtgtactcatatttattatgccaccaatggaggaaacttgagatctaccatcact
gtgttccctaaaagaacagacggagagcatgatttccgtgtgtggaacagtcagcttata
aagtacgcaggctatcagatggaagatggtagtgtgattggagacccatcaagtgtggag
tttacacagcatttggagacagaagttcgtctacgtggaggctgtccagctgattgggtg
tggttggtcccgcccatgtctggctccctcacccccgtgtaccatcaggagatgctcaac
tacatcctttcccccttcttctactaccaggctgatgcatggctaacacacaagtggaaa
gatgagaagaaaggtcttcgaagatgtaaggtcagcttcaaaggactcataagagcagtt
tttttttctcaaatgctcatcaaagcagtcatggccaagagggtgtgctgcactgttact
ctagctacagaaacagggaagtcactgacctttgccaaaaaactgaacaccactagcctc
aaccgtgccttcgactccaagctggtatgcatggaggactatgatttcagtgagcttgag
acagagagccttctgatggtggtcaccagtactttcggcaatggggaaagcccaggaaat
ggagtgagtttcaagaagcagcttttcagcttgcaaaacctgaaaaacaccgtcaggtac
agcgtgtttggccttggctcacgtgtgtacccacaattctgtgcctttgcccatgctgtg
gatgacaagcttgctgagttgggggccaagcgtctgactgccacaggggagggagatgaa
cttaatgggcaggatgaggctttctctgcttgggcttgcactgcttttaaggatgcatgt
gaggagtttaacattaaaaaacagctgaaagctgttgagcaacagtcggacgactgggac
ccacagagatacagagtgcagcataacagttgcactctggaccgagttacagcactgtca
gctcttcactctaaaactgtgtttcctatgacgctgaaaagaaggcagaaactgcagtgc
gctcaatcaagtcgttctactatcctggttgagctgaagacagatggaaacacagaggcc
ttgaactttgcccctggagatcatgtggggatttttccagagaattctcaagagctggtg
gatggtattttgaagcacctcccagatgcccctccagtcaaccagagttttcacctggag
tccctttcagactctagccatgtgtgtcaaaatccagttccatccagtcagtctattttg
ttcatcaaatgcatttacactgggatcagttggtgtcttcagtctgtaactgtaagcttg
tgttgtttggagcagatgtatgtgcaggatgtcttgagggagcagctctctgaaaaagcc
gtggaggttctacacaaaaacgcaggccatctgtatgtctgcggtggcatgaacatggcc
cgagatgttgcttgcactttgcaagatatcctggcaagtaaaacaggcatggccatcgca
gaagctggagaatatctggagaggatgaaggttgagaagagataccatgaagacattttt
ggagcttaa

DBGET integrated database retrieval system