KEGG   Cyprinus carpio (common carp): 109080954
Entry
109080954         CDS       T05134                                 

Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta-like
  KO
K04692  signal transducer and activator of transcription 3
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04068  FoxO signaling pathway
ccar04217  Necroptosis
ccar04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109080954
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109080954
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109080954
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ccar03000]
    109080954
Transcription factors [BR:ccar03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    109080954
SSDB
Motif
Pfam: STAT_bind STAT_alpha SH2
Other DBs
NCBI-GeneID: 109080954
NCBI-ProteinID: XP_018951505
LinkDB
Position
Unknown
AA seq 442 aa
QELAQQVQTLQVQPAAMELESQRQVEKSLKDLKTKVEVMEHSIRCLEEQQDEFDFKYQTH
LMDCCTEEEKKMQAEGLQKMLNALDKCRKVGKFFFNLLETAFVVETQPSMPQGRGSLVLR
TNVQFSVKVRLLYKVSELNHVMKVTVSVNNAASQLKGFRKFNVLGTLSKALNMAESMNGG
MVADFRHLTLKDQKVGGGGKGINDLSLSVTEELHRIIFQTQFDYQGLSVPLETFSLPVVV
ISNSSQQQSAWASVLWFNMLCSDPENVKFFETSPAATWPQFGEMLSWQFLSCGKRGLDND
QLETLAIKLFGKQQSYDNCKISWTKFSKENLPDTNFSLWVWLDGILTLVKLYLSDLWSDG
SIMGFVSKGKERLLLKKKQNGTFLLRFSESIKDGGITFSWVQYANDGKPCHKIICTSFRH
SSVFGHAGSSECETEYTYKNKN
NT seq 1330 nt   +upstreamnt  +downstreamnt
acaagagcttgcacagcaagtgcagacattgcaggttcagccagcggcaatggagctgga
gagccagagacaagtagaaaagagtttgaaagaccttaagaccaaagtagaggtgatgga
gcacagcataaggtgtttggaggagcagcaagatgagtttgattttaaatatcagacaca
cctaatggactgttgcacagaagaagagaagaaaatgcaagcagaagggcttcagaagat
gctaaatgcactcgataaatgcagaaaggttggcaaatttttttttaatctgttggagac
tgcatttgttgtagagactcagccatccatgccacaaggtcgaggctccctggtgctgcg
cacgaatgttcagttctcagttaaagtcagattgttatataaagtttctgaactgaacca
tgttatgaaggtgactgtttctgttaacaatgctgcttcacagctaaaagggtttcggaa
atttaatgtgctgggtaccttaagtaaagctcttaacatggctgagagtatgaatggggg
catggtcgctgatttcagacatttgactttgaaagatcagaaagttggtggtggaggaaa
aggaatcaatgatctctcattgagtgtgactgaagaactgcacagaataatctttcaaac
ccagtttgactatcaaggcctgtctgtccctttggagaccttttcccttcctgttgtggt
gatttcaaactccagtcagcagcagagtgcttgggcatccgttctgtggtttaacatgct
ctgttcagatcccgagaacgtcaagttttttgaaacctctcctgcagccacttggccaca
gtttggggaaatgctaagttggcagtttctctcttgtgggaaacgtggtctagacaatga
ccagttggagaccctcgccatcaagctctttggtaaacaacagagctatgacaactgtaa
gatatcctggaccaagttcagtaaggagaacctccctgatacaaacttcagcctgtgggt
gtggctggatggcattctaaccctggttaaactctacctgtcagatctgtggagtgatgg
gtctataatgggctttgtcagcaaggggaaggagagacttttattaaagaagaagcagaa
tggcactttcctattgcgttttagcgaaagcatcaaagatggaggaatcacattcagctg
ggtgcagtacgcgaacgatggtaaaccatgccataaaataatatgtacttctttcagaca
tagttcagtatttggccacgcagggtccagtgaatgtgagactgaatacacatataaaaa
taaaaactaa

DBGET integrated database retrieval system