KEGG   Cyprinus carpio (common carp): 109081850Help
Entry
109081850         CDS       T05134                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: potassium voltage-gated channel subfamily KQT member 1-like
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109081850
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ccar04040]
    109081850
Ion channels [BR:ccar04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   109081850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans
Motif
Other DBs
NCBI-GeneID: 109081850
NCBI-ProteinID: XP_018952358
LinkDB All DBs
Position
Unknown
AA seq 442 aa AA seqDB search
MRGMTLGNSHHRLFLDDRKSVIAVRESRNLIVWNLIKSRTLLNLRPQDVDEFVSSIELSY
LLYVRRFLMVLVCLIFSVLSTIEQYADFATGSLFWMEIVLVVFFGTEYVVRLWSAGCRSK
YVGIKGRLRFIRKPISIIDLIVVVASVVVLSVGSNGQVFATSAIRGIRFLQILRMLHVDR
QGGTWRLLGSVVFIHRQELITTLYIGFLGLIFSSYFVYLAEKDAVDEEGKTGFSSYADAL
WWGVTVFLCVQGILGSGFALKVQQKQRQKHFNRQIPAAASLIQTLWRCYACEKSDSCTAT
WKMYVLTGDYIPIINSENSSPGNFRRLSKRYKRKPKVTRDNGSLGPGGERTLSIPQITYD
HIDDKDGVFSEESTDRQRSWSAFALICPSSPAAQRGQKSPLKFLKISCTSFMDDSDMRGM
TLGNSHHRLFLDDRKSVIAVRE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaggggcatgactctgggaaacagccatcaccggcttttcctggatgaccggaaatct
gtaatcgctgtcagagagagcagaaacctgatcgtgtggaaccttattaagagcagaacc
ttactcaaccttaggccacaagatgtagatgagtttgtttcttcaatagaactatcttac
cttctttatgtccgcaggttcctcatggtcctagtctgcctgatattcagtgtcctgtcc
accattgagcagtatgcagacttcgcaacaggatctctcttctggatggagatcgtgctg
gtggtgttttttgggacggagtacgtggtccggctgtggtcagctggctgtcggagcaaa
tatgtgggtattaaaggccgtctgaggttcatcaggaaacccatctccattatagatctg
atagtggtcgtcgcctctgtcgtggttctgagcgttgggtctaatgggcaagtgttcgcc
acgtccgcaatcagagggatccgtttcctccagatcttgcgaatgttgcatgtggatcgt
cagggtggaacgtggaggcttctgggatcagtggtttttattcatcggcaggagctgatc
accacgctgtacatcgggttcctgggtctgatcttctcgtcgtattttgtgtatctggca
gagaaagacgcagtagacgaggaggggaagacgggtttttctagctatgccgatgctctg
tggtggggtgtgactgtcttcctctgtgtgcagggcattctgggatctggttttgctctt
aaagtccagcagaaacagaggcagaaacattttaaccggcagattccagccgcagcctct
ttaatacagacgctgtggagatgctacgcctgcgagaagtccgatagctgtacggccacg
tggaagatgtacgtgctgacgggcgactacatccccatcataaactctgaaaactccagc
ccgggcaacttcagacggctgagtaagaggtacaaacggaagccgaaggtcacacgtgat
aacggttctctgggtcccggaggagaacgaaccctctccatcccacaaatcacctacgac
cacatcgatgataaagacggagtcttttctgaggagtccactgaccgccagcgctcgtgg
tctgctttcgctctcatctgtccttcttctccagctgctcagagaggtcagaaatctcct
ctgaagtttttaaaaatcagttgtacatcatttatggatgactccgatatgaggggcatg
actctgggaaacagccatcaccggcttttcctggatgaccggaaatctgtaatcgctgtc
agagag

DBGET integrated database retrieval system