KEGG   Cyprinus carpio (common carp): 109081956Help
Entry
109081956         CDS       T05134                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04115  p53 signaling pathway
ccar04140  Autophagy - animal
ccar04150  mTOR signaling pathway
ccar04218  Cellular senescence
ccar04910  Insulin signaling pathway
ccar05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    109081956
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109081956
  09143 Cell growth and death
   04115 p53 signaling pathway
    109081956
   04218 Cellular senescence
    109081956
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109081956
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109081956
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ccar01009]
    109081956
Protein phosphatases and associated proteins [BR:ccar01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109081956
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tuberin
Motif
Other DBs
NCBI-GeneID: 109081956
NCBI-ProteinID: XP_018952450
LinkDB All DBs
Position
Unknown
AA seq 310 aa AA seqDB search
METDWKVLKLVLDKMSCTIQYKVLIRTSPCNIDHLCSTLCSMVTDRLISERLKKTPDGFS
LTDVQLAVVPVLTALTSYHSYLEQSRQRELVQCLEKGLIYRCAKQCVVALTMCTVEMPDI
MIKLLPALIVKLTHISATVAMASPMLEFLSTLVRLPHLYANFVAEQYVSVFAISLPYTNP
SKFNQYIVSLAHHVIAMWFIRCRLAFRKDFVQYITKGLRSNALLPFDDTHEQSSFRARST
SLNERPKSLRTTKVAKQGPSANSPVKDLKDLSAMDAFRSRSISVSEHAVRRMQTSSTTCS
LGSADENAVG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggagactgactggaaggttctgaagctggttctggataagatgtcctgcaccattcag
tacaaagttctaatccggacctcaccctgcaacatcgatcatctgtgctccactctctgc
tccatggtgacagaccgtctgatatcggagcgtttgaagaagactcctgatggattctcc
ctcactgatgttcagctcgctgtggttcctgttctcactgccctcacctcctaccacagc
tacctagagcagtcccgacagagggagctggtccagtgtttggagaagggcctgatttac
cgctgtgctaagcagtgtgtggtggctctgaccatgtgcaccgtagagatgcccgacatc
atgatcaaactcctgcccgccctcatcgtcaagctcacgcacatctcggcaaccgttgcc
atggcctcgcccatgctggagttcctgtccacattagtgcggctcccacatctgtatgct
aactttgtagccgagcagtacgttagcgtgtttgccatatcgctgccgtacaccaacccc
tcaaagtttaatcagtacatagtgtctctcgcccatcatgtgatcgccatgtggttcata
cgctgccgactggctttcaggaaagacttcgttcagtacatcaccaagggtcttcgttca
aacgctcttctgccgttcgatgacactcacgagcagagcagctttagagcgcgcagcacc
agcctgaacgagaggcccaagagtttgcggacgaccaaagtggcgaagcaaggccccagc
gcaaactctcccgttaaagacctgaaagatctgtcggccatggacgccttccgctcccga
agcatcagtgtgtccgagcatgcggtgcgcaggatgcagacgtccagcaccacctgcagc
ctgggctcggctgacgagaacgcggtcggctga

DBGET integrated database retrieval system