KEGG   Cyprinus carpio (common carp): 109082177Help
Entry
109082177         CDS       T05134                                 

Definition
(RefSeq) putative hexokinase HKDC1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00010  Glycolysis / Gluconeogenesis
ccar00051  Fructose and mannose metabolism
ccar00052  Galactose metabolism
ccar00500  Starch and sucrose metabolism
ccar00520  Amino sugar and nucleotide sugar metabolism
ccar00524  Neomycin, kanamycin and gentamicin biosynthesis
ccar01100  Metabolic pathways
ccar01200  Carbon metabolism
ccar04910  Insulin signaling pathway
Module
ccar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ccar_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ccar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109082177
   00051 Fructose and mannose metabolism
    109082177
   00052 Galactose metabolism
    109082177
   00500 Starch and sucrose metabolism
    109082177
   00520 Amino sugar and nucleotide sugar metabolism
    109082177
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    109082177
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    109082177
Enzymes [BR:ccar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     109082177
Membrane trafficking [BR:ccar04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    109082177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD OpuAC
Motif
Other DBs
NCBI-GeneID: 109082177
NCBI-ProteinID: XP_018952640
LinkDB All DBs
Position
Unknown
AA seq 919 aa AA seqDB search
MFAVHLLSFYFSKLQEDQIKKVDRYLYAMRLSDDQLVDISARFRREMEKGLSNESNATAA
VKMLPTHVYSTPDGSEKGEFLALDLGGSKFKVLQVKVSEDGKGKVQMDSETFPIPEEILN
GRGTELFEHVAESLKSFLQQHHINHTRKPLGFTFSFPCAQSKIDEGVLLSWSKNFKARGV
QGNNVVQLLRKAIQRVGDVDVDVLAMVNDTVGAMMTCGYDDQNCEVGVIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGVLDDFITSFDSEIDAASINPGKQLFEKMVSGM
YMGELVRLILLKMAKKGLLFHGQVSDALRTKGTFQTKHICSIEQYKDGLKNTKEILEDLG
LSPSEDDCIAVQHVCTIVSFRSANLVAATLAAILTQIRENKKLKTLRTTVGVDGTVYRTH
PQYPKRLHKVVRHLVPDCHVRFVLSESGSAKGAAMVTAVAQRLASQRKEIDDTLATFTLS
TTQLQEVKAKMRVELERGLKKDTHPTASVKMLPTYVYRTPDGTERGKYLALDLGGTNFRV
LVVKIRTGMRNSVRMYNKIYAIPLEIMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCNQTGIDKGDLVSWTKGFKATDCEGYDVVDMLREAIKRRNEFDLDIVAIVNDTVG
TMMTCAYEDPKCQIGLIAGTGSNVCYMEEMKNIELVEGDEGQMCVNTEWGGFGENDNIED
IRTRYDREVDGGSLNPGKQRFEKMTSGMYLGEIVRQILIDLTKRGLLFRGRITERLKTKG
IFETKFLSQIESDRLALLQVRSILQSLGLDSTCDDSIIVKEVCGAVSRRAAQLCGAGMAA
IVDKIRENRGLDHLEITVGVDGTLYKLHPHFSTILKDTVRELAPNCKVDFILSEDGSGKG
AALITAVARQHQREKQEPH
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtccatttactgtccttctacttttcaaagcttcaggaggatcagatcaag
aaggtagaccgatatctgtacgcaatgcgtctgtcagatgatcagctcgtggatatatca
gctcggtttcgacgggagatggagaaaggactgtcaaatgagagcaatgcaacagctgca
gtgaagatgctgccgacccacgtttattccacacctgatggctcagagaagggtgagttt
ctggcactggatctggggggttcaaaatttaaggtgctacaggtgaaggtttcagaagat
gggaagggcaaagtccaaatggatagtgaaacctttcccatccctgaagagatccttaat
gggagaggaactgagctttttgagcatgtggcagaatctttgaagtcttttctacaacaa
caccacattaatcacacaagaaaacctctcggcttcaccttctctttcccatgtgcgcag
tccaaaatagatgagggtgtcttgctgtcatggtcaaagaatttcaaggctagaggtgtt
caagggaataatgtggtgcagttattacggaaagccattcaaagagttggggatgttgac
gtggatgtcctggctatggtcaatgacacagtgggggccatgatgacctgcggatatgat
gaccagaactgtgaggtgggggttattataggaaccggcactaatgcttgctacatggag
gaaatgcgacacattgatctggtggaaggagatgaaggcaggatgtgtattaatactgaa
tggggagcatttggagatgatggtgtgcttgatgatttcatcacaagctttgacagtgaa
attgatgctgcctcaattaatccaggaaaacagctttttgaaaagatggtgagtgggatg
tacatgggagaacttgtgagactcattttgctgaagatggccaaaaagggtctactcttt
catggccaagtatctgatgctcttcgaaccaaaggaactttccagaccaaacatatctgc
tcgattgaacagtataaagacggtttgaagaacaccaaagagatccttgaagacctgggt
ctaagtcccagtgaagatgactgcattgctgtccagcatgtttgtaccatcgtctccttc
aggtcagctaatctggttgctgccactttggctgccattctgacacaaatccgagaaaac
aagaagctcaaaacccttcggaccacagtaggagtggatgggacggtctacagaacacat
ccacagtatcccaagaggctccacaaggtggtccgtcatctggtgccagactgtcatgtt
cgttttgtgctgtctgaaagtgggagtgcaaaaggtgctgccatggtgactgcagtagct
cagcggctagcgtcccaaagaaaggagattgatgatactctcgcgaccttcaccttgagc
accacacagcttcaggaagtgaaggcgaagatgcgcgtggagttggaacgaggcttgaag
aaagacacccatcccactgcttcagtcaaaatgcttcctacatatgtttacaggactcca
gatgggacagaaagaggaaagtaccttgccttggatcttggcggaaccaatttccgcgtg
ttggtggttaagattcgtaccgggatgcgaaattcagtccggatgtataacaagatttat
gcaattccattggagatcatgcagggaacaggagaggagttgtttgaccacatagttcag
tgcatctcagatttcttggactatatggggatgaagaacactcgtctgccacttggcttc
accttctctttcccatgcaatcagacaggtattgataagggagatctggtctcctggaca
aaaggcttcaaagcgacagattgcgaggggtatgatgttgtggatatgttgagagaagcc
atcaaaagacgaaatgaatttgaccttgatattgttgctatagtgaatgacacagttggc
acaatgatgacatgtgcatatgaggaccctaaatgtcagattggtctcattgctggaacg
ggaagcaatgtgtgttacatggaggagatgaagaacattgagcttgtggagggtgatgaa
gggcagatgtgtgtgaacactgagtggggaggatttggagaaaatgataatattgaggac
atccggactagatacgacagagaagtggacggaggctcactcaatccaggaaaacaaagg
tttgaaaagatgaccagtggaatgtatttgggagagattgtaaggcagatcctcattgat
ctcacaaagcgtggtcttttgtttcgtggtcgcatcacagagagactgaagaccaaaggc
atctttgagaccaagttcctttcacagattgagagtgaccgtttggctctactgcaagtg
aggtctattctgcagagtctgggcttggacagcacatgtgacgacagtattattgtaaag
gaagtgtgtggagctgtttcccgtcgagcagctcagctctgtggagcaggaatggctgct
attgtagacaaaatcagagagaaccgtgggctggatcatctggagattactgtgggagtg
gacggcacgctttacaagttgcatccacacttctccacgatcctaaaggacactgtcaga
gagcttgcgcccaattgtaaggtggatttcatcctatcagaggatggcagtgggaaaggg
gcggccctgatcacagcggtagcacggcagcatcaaagagagaaacaagaacctcactag

DBGET integrated database retrieval system