KEGG   Cyprinus carpio (common carp): 109082331Help
Entry
109082331         CDS       T05134                                 

Gene name
vps41
Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109082331 (vps41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ccar04131]
    109082331 (vps41)
Membrane trafficking [BR:ccar04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    109082331 (vps41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Vps39_2 TPR_7 Vps39_1 TPR_17 FAD_binding_1
Motif
Other DBs
NCBI-GeneID: 109082331
NCBI-ProteinID: XP_018952767
LinkDB All DBs
Position
Unknown
AA seq 847 aa AA seqDB search
MAEVEDQGRKLSEESTDESEEEDTEEEPKLKYERLTNGVTEVLQKDAASCMTVHDKFLAL
GTHFGKVYLLDIQGNVTQKFEISLVKINQISLDESGDHVGICSENSKVQVFGLYTREGFH
ENFDCPIKVVALHPQFSKSNNKQFVTGGNKLLLYERNWLNRWKTSVLHEGEGNITNVKWR
ANLIAWANNLGVKIYDIGSKQRITNVLRDNTSLRPDMYPCSLCWKNNTTLIIGWGSSVKI
CVVKERDPTEIRDLPSRYVEIVSAFETEFFISGLAPLADQLVTLYYVKENSEHMEEEFRT
RPRLDIIQPLAEGCEEISSDALTVRNFQENQCRDYRLEHSEGESLFYIISPKDIVVAKER
DQDDHIDWLLEKKKYEEALMAAEISFKNIKRHDVQKIGMAYINHLVERGDYDAAARKCQK
VLGKNMDLWENEVYRFKTIGQLKAISQYLPRGDLRLRPAIYEMILHEFLKTDYEGFATLI
REWPGELYNNMAIVQAVNEHLKKDPTNSMLLTTLAELYTYDQRYDRALEIYLKLRHKDVY
QLIHKHNLFSSIKDKIVLLMDFDKEKAVDMLLDNEDKISMDKVVEELKDRPELLHVYLHK
LFKRDHHKGQKYHERQISLYAEFDRPNLLPFLRESMHCPLEKALEICQQRHFVEETVFLL
SRMGNCRRALQMIMEELADVDKAIEFAKEQDDRELWEDLISYSIDKPPFITGLLNNIGTH
VDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLQRMHRTQK
RGVRVDEENICESCHTPILPSDTAQAFGVVVFHCRHMFPSVVPGIQYCNICSAKRRGPGS
GILEMKK
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagtggaggaccagggaagaaaactaagtgaagaatccacagatgagtcagag
gaggaggatacagaggaggagcctaaactgaagtacgagaggctgaccaatggtgtgacc
gaggtcttgcagaaggatgcggccagctgcatgacagtgcatgacaagttcctggctctt
gggacacactttgggaaggtttaccttctggatatccaaggaaatgttacacagaagttt
gaaattagtctagtgaaaataaaccagatcagtttggatgagagcggtgatcatgttggc
atctgttctgaaaatagcaaagtgcaagtgttcggcctgtacaccagggagggcttccac
gaaaactttgactgtcccatcaaggtcgtggcgctacaccctcagttcagcaaatccaac
aataaacagtttgtgactggaggaaataagcttttactttatgagaggaactggctgaac
cgttggaagacatctgttctgcatgaaggagagggaaacatcaccaatgtgaaatggaga
gccaatctcattgcctgggcaaacaatttgggtgtaaaaatttacgacatcggcagtaaa
cagcgcatcactaacgtgttgcgggacaacaccagtcttaggccggatatgtacccctgc
agtctgtgctggaaaaacaacaccacgctgatcatcggctggggctcttctgtgaagata
tgtgttgttaaagagcgtgacccaacagaaattagagatctacccagtcgctacgttgag
attgtgtcagcatttgagacagagttcttcattagtggattggcgcctttggcagatcag
ctggtcactctgtactatgtcaaggagaactctgagcacatggaggaggagttcagaaca
cggcctcgtttagacatcatccagccgttagctgagggctgtgaggagatctcatcagac
gctctcactgtacgcaacttccaggagaaccagtgcagggactacagactcgaacactct
gagggagagtctctattctacatcatcagccctaaagacattgtagtggctaaagaaaga
gaccaggacgaccacattgactggcttctggagaagaagaaatatgaggaagcactgatg
gctgcagagatcagcttcaaaaacattaaacggcatgatgtacagaaaattggaatggcg
tacatcaatcatttggtggagaggggagattatgatgcagctgccagaaagtgtcaaaaa
gtgctcggaaagaacatggatctctgggagaatgaagtgtacagattcaaaacaattgga
cagttgaaagccatcagtcagtacttaccaagaggagaccttcgtcttcgaccagcaatt
tatgagatgatacttcatgagttcctcaagactgactatgagggttttgccacactgatt
cgtgagtggccgggagagctgtataacaacatggctatagttcaggcagtgaatgaacac
ctgaagaaggaccctaccaacagcatgctcctcaccacactggccgaactctacacgtat
gatcagcgttatgatcgcgctctggagatctacctgaaactcagacacaaagatgtttac
cagctcattcacaaacacaacctgttctcctccatcaaagataagattgtcctgctcatg
gatttcgacaaagagaaagctgttgacatgctgctggataatgaagataaaatatcaatg
gacaaagtggtggaggaattaaaagacagacctgagctgttacatgtgtatttgcataag
ctgtttaagcgggaccaccataaggggcagaagtaccatgagaggcagatcagtttgtat
gctgagtttgaccgacccaacctcctacccttcctcagagagagcatgcactgcccacta
gagaaggctctggaaatctgtcagcagaggcactttgtagaagagacggtcttcctgctc
agtcgtatgggaaactgcagacgtgccctgcagatgatcatggaggagctggcggatgtg
gacaaagccatcgagtttgctaaagagcaggatgacagagaactctgggaggatctcatc
tcttactctatagacaaaccaccgttcatcacaggcctcttgaataacatcggaacccat
gtggaccccatcctgctcattcaccgcattaaagaaggaatggagattcctaacctcaga
gactcgctggttaagatcctacaggactacaatcttcagatcttactgagagagggctgt
aagaagatcctggttgcagattcactgtctcttctacagaggatgcacaggacgcagaag
agaggagtgcgggtggatgaagaaaacatctgtgaatcctgccacactcccattctacca
tcagacacggctcaggcattcggtgtggtggtgtttcactgcagacacatgttcccttct
gtagttccaggaatccagtattgtaacatctgcagtgcaaagcggagaggaccgggcagt
ggcatactggagatgaagaaataa

DBGET integrated database retrieval system