KEGG   Cyprinus carpio (common carp): 109085104
Entry
109085104         CDS       T05134                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar04012  ErbB signaling pathway
ccar04068  FoxO signaling pathway
ccar04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109085104
   04068 FoxO signaling pathway
    109085104
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109085104
SSDB
Motif
Pfam: CDI SPDY
Other DBs
NCBI-GeneID: 109085104
NCBI-ProteinID: XP_018955293
LinkDB
Position
Unknown
AA seq 179 aa
MSNVRLSNGSPTLERMEARLSDQPKPTACRNLFGPVDHEELKKDFQRQLKAMEDASTDAW
NFDFSTHTPRADGRYQWEALDIRSVPGFYSRSVRAKGSDLHICSSGNNNDNNVDVNGNHD
CRVTEQSAETPEKDREHRKRASCLDSSCQSKRSHICVDEVTRTPRKPKTPRKHPSPTLT
NT seq 540 nt   +upstreamnt  +downstreamnt
atgtccaacgttcgcttgtctaacggcagcccgacgctggaacggatggaggcgcgactg
tccgaccagcccaagccgacggcgtgtcggaacctgttcggtccggtggatcatgaagag
ttaaaaaaggacttccagcggcagctgaaggcgatggaggacgcgtcgacggacgcgtgg
aacttcgacttctccacgcacacgccgcgcgccgacggcagataccagtgggaagcgctg
gacatccggtcggtgcccggtttctacagcagatcggtgcgggcgaagggctccgatctt
cacatttgctcctctgggaataataacgacaataacgtggatgttaacggcaatcacgac
tgtcgggtaacggagcagagcgcggagacgcccgaaaaagaccgagagcacaggaaaaga
gcctcctgtctcgactcctcgtgtcaaagcaaacgctcacacatatgtgtggatgaagtg
acgcggacgccgagaaaacccaaaacaccccgaaaacaccccagccccacacttacataa

DBGET integrated database retrieval system