KEGG   Cyprinus carpio (common carp): 109085159Help
Entry
109085159         CDS       T05134                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ccar  Cyprinus carpio (common carp)
Pathway
ccar00020  Citrate cycle (TCA cycle)
ccar00190  Oxidative phosphorylation
ccar01100  Metabolic pathways
ccar01200  Carbon metabolism
Module
ccar_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ccar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109085159
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109085159
Enzymes [BR:ccar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109085159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 109085159
NCBI-ProteinID: XP_018955340
LinkDB All DBs
Position
Unknown
AA seq 144 aa AA seqDB search
MEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENFGMPFSRTEEGKIYQRAF
GGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECKG
VIALCMEDGSIHRFRAKNTVIATG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggacaactggcgttggcacttttatgacacagtgaagggatctgattggctg
ggagaccaggatgccattcactacatgacagagcaggcgcctgctgcagtggtggagcta
gagaacttcggtatgccgttcagccgtaccgaggaagggaagatctatcagcgtgccttc
ggaggccagagtctgaagttcgggaaaggaggtcaggctcatagatgctgttgtgtggcg
gacaggacgggtcactctcttcttcatacgctgtatggacggtctctaaggtatgacacc
agttattttgtggaatattttgctctggatctgctgatggaggatggagagtgtaagggg
gtcattgcgttgtgcatggaggacggatccatccaccgcttcagagccaagaacacagtc
attgccacggggtga

DBGET integrated database retrieval system